KEGG   Sulfurisphaera tokodaii: STK_05790
Entry
STK_05790         CDS       T00062                                 
Name
(GenBank) RadA paralog
Organism
sto  Sulfurisphaera tokodaii
SSDB
Motif
Pfam: ATPase AAA_25 RecA AAA_14 AAA_22 MEDS nSTAND3 Rad51 GvpD_P-loop PAXNEB DnaB_C IstB_IS21 AAA_24 ResIII RNA_helicase ATPase_2 SLFN-g3_helicase ABC_tran NTPase_1 AAA DUF2935 AAA_19 NACHT AAA_16
Other DBs
NCBI-ProteinID: BAK54336
UniProt: F9VN39
Position
complement(566923..567699)
AA seq 258 aa
MIRLSTGIPEFDKLIEGGIPQGFFVAVTGEPGTGKTIFSLHFIAEGLREGDNCIYVTTEE
SRDSIVRQAKQFNWDFEEYMEKKLIIIDALMKEKEDEWSLTELNAEELVNKVIEAKQKLG
TGRARLVIDSVSALFLDKPAMARKISYYLKRVLNKWKFTIYATSQYAITTSQAFGFGVEH
VADGIIRFRRAIKDGMLHRYVLIEKMRQTNHDKYVWEIDIKPGKGIVLLGKINERREDYA
LPPKVMQKIKEANEDKIT
NT seq 777 nt   +upstreamnt  +downstreamnt
atgattagactgtcaactggtataccagaatttgataaacttatagagggagggatacct
caaggattctttgttgcagttactggagagcctggtactgggaagactattttctcttta
cattttattgctgagggacttagggaaggagataactgtatatatgttactactgaggaa
agtagagattcgattgtaagacaagcaaagcagtttaattgggatttcgaagagtatatg
gagaagaaactgattatcatagatgcattaatgaaagaaaaagaggatgaatggagttta
acagagctgaatgctgaggagttagtgaataaagttatagaagctaaacaaaaattaggg
actggaagagcaagactagttattgattcagtaagtgccctatttcttgataaacccgct
atggctagaaaaataagttattacttaaagagagtattaaataaatggaagtttactatt
tacgctacgtcgcaatatgcaattacaacatcgcaagcctttggatttggagtagaacat
gtagctgatggaataataagatttagaagagctataaaggacggaatgttgcatagatac
gttctcatagaaaaaatgagacaaactaatcatgataaatacgtttgggagattgatatt
aagccaggaaaaggaattgtattactaggtaaaataaacgagagaagagaggattatgca
ttacctcctaaagttatgcaaaagattaaggaagctaatgaggataaaattacataa

DBGET integrated database retrieval system