KEGG   Sulfurisphaera tokodaii: STK_05900
Entry
STK_05900         CDS       T00062                                 
Symbol
hjm
Name
(GenBank) Holliday junction migration helicase
  KO
K03726  ATP-dependent DNA helicase [EC:5.6.2.4]
Organism
sto  Sulfurisphaera tokodaii
Brite
KEGG Orthology (KO) [BR:sto00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:sto03400]
    STK_05900 (hjm)
Enzymes [BR:sto01000]
 5. Isomerases
  5.6  Isomerases altering macromolecular conformation
   5.6.2  Enzymes altering nucleic acid conformation
    5.6.2.4  DNA 3'-5' helicase
     STK_05900 (hjm)
DNA repair and recombination proteins [BR:sto03400]
 Prokaryotic type
  DSBR (double strand breaks repair)
   HR (homologous recombination)
    Archaeal homologous recombinant proteins
     STK_05900 (hjm)
SSDB
Motif
Pfam: DEAD Helicase_dom4_arc ResIII Helicase_C HTH_61 SNF2-rel_dom HHH_5 HHH IMS_HHH DNA_pol_lambd_f
Other DBs
NCBI-ProteinID: BAK54341
UniProt: Q974S1
Position
576108..578222
AA seq 704 aa
METISIDDLPLDIKIIDILKRRGIRTLNPPQSEAIRKGLLDGKRLLVTSPTASGKTLIAE
LGMINYLLSKGGKAIYITPLRALTNEKYNTFKDWETLGIKTGMTSGDYDTDDAWLENYDI
IVTTYEKLDSLWRHKAKWLNEVSYFVLDEFHYLNDPERGPTVESVAIRAKKRGIVLGLSA
TISNGKEIANWLNAELVATNWRPVPLKEGIIYPEKKGFVVVYKDNTSRKVYGDDAIIAYT
LDIVSKGGQVLVFRSSRKLAENTARKIVQYMNFVKLEDKKLLEIARKIKEVEDAGSNEKE
DLYNLVLRGVAYHHAGLSKGLRDIIESSFRDRILKVIVATPTLAAGVNLPARAVVIGDIY
RYNRKVVGYMDLIPVMDYKQMSGRAGRPGFDENGEAVVVVRNKREAEKVYERYLMSDVEP
IESKLGSESAFYSFLISIIASEGEKTTEELMEYVKETLLPKELAKKYFRSGLDWLLQHDI
FAEISDKITLTRFGRRISDLYINPFTAVTIREALEKNEKGCEIAYLHLLAYTPDGPSIGV
SRAEEDALIDELNCELFVDEPEDEYEFSNYISALKVAYIVYDWVNEIDEDTILGKYGIGS
GDLRAIIDTMDWLTYSGYHVASVLELKDHKDILEELHARVKDGVKPELIELVKIPGIGRV
RARLLYQHDIKKPEDIVLNPEKVKQLLGPNLGEKIVREAARTIA
NT seq 2115 nt   +upstreamnt  +downstreamnt
atggaaacaatttctattgacgatttgccgttagacataaaaattatagatattttaaaa
agaagaggaattagaactcttaacccaccacaatctgaagcaataagaaaaggtttacta
gatggaaaaagactcttagtaacatctcctactgcttctggtaaaactctcattgcagaa
ctaggtatgataaattatcttctatcaaaaggcggaaaagcaatatatattaccccactt
agagcattaactaatgaaaaatataatacgtttaaagattgggaaactcttggtataaaa
actggaatgacaagtggagattacgatactgatgacgcatggctcgaaaattatgatata
atagtaactacttacgaaaaattagattctttatggagacataaggctaaatggcttaac
gaggtttcatattttgttttagatgagtttcattatttaaacgatccagaaaggggtcct
accgttgaatcagttgctattagagcgaagaaaagaggcatagtattaggattaagtgca
acaattagtaatggtaaagagatagctaactggttaaatgctgaactagtagctactaat
tggagacccgtcccgctaaaagaaggaataatatacccagaaaagaaaggatttgtagta
gtgtacaaggataataccagcaggaaagtatatggggatgatgctataatagcttacaca
ctagatatagtttcaaaaggaggacaagttttagtgtttcgctcttcgagaaaattagcc
gaaaatacagctagaaaaatagttcaatatatgaattttgtaaaattagaggataagaaa
ttactggaaatcgctagaaaaattaaagaagtcgaagatgcagggagtaatgagaaagag
gacttatataaccttgtattaaggggtgttgcttatcatcatgcaggtctctctaaagga
cttagggatataatagaatcttcttttagagatagaatattgaaagtgatagtggcaaca
cccacattagctgctggagttaatttacctgctagggctgtagttataggtgatatttat
agatataatagaaaagttgtcggatatatggatttaatcccagttatggattataagcaa
atgagtggcagggctggaagaccaggttttgatgaaaatggagaagctgttgtagttgtt
aggaacaaaagagaggcagaaaaagtatacgaaaggtatttaatgtctgatgtggaacca
attgaatcaaaattaggttcagaaagtgcattttattccttccttattagtattatagca
tctgaaggtgaaaaaaccacagaggaactaatggaatatgtaaaggaaaccttacttccg
aaagaactagctaaaaaatattttagatctgggttagattggttactacaacatgatatc
tttgctgaaatcagtgataaaatcacattaactagatttggaagaagaatctcagatcta
tatataaatcctttcactgcagtaacaattagagaagccttagagaagaatgagaaagga
tgcgaaatagcatatcttcacttgttagcttatactccagatggtccttcaattggagtt
agtagagctgaagaagatgcacttatagatgagttaaattgtgaactatttgttgatgag
cctgaagatgaatacgaattttcaaattacatatcagcattaaaagtagcttatattgtt
tatgattgggtaaatgaaatagatgaagatacaatcctagggaagtatggaataggatca
ggtgatttaagggctataatagatacaatggattggttaacttattctggttatcatgta
gcctccgtcctagaattaaaagatcataaggatatcttagaagaacttcatgctagagtt
aaagacggagttaaaccagagctgattgaattggtaaagattcctggaataggaagagta
agagccagactactttatcaacatgatattaagaaaccagaagacattgtactaaaccca
gaaaaggttaagcaacttttaggtcctaacttaggtgaaaaaattgtcagagaagctgca
agaactattgcttga

DBGET integrated database retrieval system