KEGG   Sulfurisphaera tokodaii: STK_05920
Entry
STK_05920         CDS       T00062                                 
Symbol
accB
Name
(GenBank) acetyl-CoA/propionyl-CoA carboxylase beta subunit
  KO
K15037  biotin carboxyl carrier protein
Organism
sto  Sulfurisphaera tokodaii
Pathway
sto00280  Valine, leucine and isoleucine degradation
sto00630  Glyoxylate and dicarboxylate metabolism
sto00640  Propanoate metabolism
sto00720  Carbon fixation pathways in prokaryotes
sto01100  Metabolic pathways
sto01110  Biosynthesis of secondary metabolites
sto01120  Microbial metabolism in diverse environments
sto01200  Carbon metabolism
Module
sto_M00375  Hydroxypropionate-hydroxybutylate cycle
sto_M00741  Propanoyl-CoA metabolism, propanoyl-CoA => succinyl-CoA
Brite
KEGG Orthology (KO) [BR:sto00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    STK_05920 (accB)
   00640 Propanoate metabolism
    STK_05920 (accB)
  09102 Energy metabolism
   00720 Carbon fixation pathways in prokaryotes
    STK_05920 (accB)
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    STK_05920 (accB)
SSDB
Motif
Pfam: Biotin_lipoyl Biotin_lipoyl_2 HlyD_3 HlyD_D23 PTS_EIIA_1 GCV_H RnfC_N PYNP_C NQRA QRPTase_N DUF2118 YqfD PS_Dcarbxylase DDE_Tnp_ISAZ013
Other DBs
NCBI-ProteinID: BAK54343
UniProt: F9VN46
Position
complement(579958..580461)
AA seq 167 aa
MKLLRVSSELGDSYVMTYDQQGNKDTVSFEDNKFEIEYIGPGWREGELLFKINGEVHRVY
VDNGFIVIDDETIFKVDRITETPIEQGKSIEELIKGKEGEILSPMQGRIVQIRVKEGDAV
NKGQPLLSIEAMKSETVISAPVGGVVQKIMVKPGQGVKKGDLLLIIK
NT seq 504 nt   +upstreamnt  +downstreamnt
atgaagttacttagggtatcttcagaattaggagatagctatgtaatgacttacgatcaa
caaggtaataaagataccgtcagctttgaggataataagtttgaaatagaatatattgga
cccggatggagagaaggagaactactcttcaagattaatggtgaggttcatagagtatac
gtagacaatggttttattgtaatagatgatgaaacgatctttaaggtagatagaataacg
gaaacaccaatagaacaaggtaagtcgattgaagagttgataaaaggaaaagaaggcgaa
attttatcaccaatgcaaggaagaattgttcagataagagtaaaagaaggcgatgctgta
aacaaaggacagccattattatctattgaggcaatgaagagtgagactgtaatatccgcc
ccagtaggtggagtagtacagaaaattatggtaaaacctggtcagggtgtaaagaaaggt
gatttattacttattattaaatga

DBGET integrated database retrieval system