KEGG   Sulfurisphaera tokodaii: STK_09520
Entry
STK_09520         CDS       T00062                                 
Symbol
cca
Name
(GenBank) CCA-adding enzyme
  KO
K07558  tRNA nucleotidyltransferase (CCA-adding enzyme) [EC:2.7.7.72]
Organism
sto  Sulfurisphaera tokodaii
Brite
KEGG Orthology (KO) [BR:sto00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:sto03016]
    STK_09520 (cca)
Enzymes [BR:sto01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.72  CCA tRNA nucleotidyltransferase
     STK_09520 (cca)
Transfer RNA biogenesis [BR:sto03016]
 Prokaryotic type
  3'processing and CCA adding factors
   CCA adding factors
    STK_09520 (cca)
SSDB
Motif
Pfam: tRNA_NucTransf2 NTP_transf_2 SMODS CAA_C_arc DNA_pol_B_palm
Other DBs
NCBI-ProteinID: BAK54422
UniProt: Q973E7
Position
925180..926421
AA seq 413 aa
MTIEEEVLKRIKPSKEDEEKLRERAQIILDRLKGYNAEIEGSFRKGTWLKGDTDIDIFVF
FPKSVGKEYLREKALKELIERFRDLNYKIAYAEHPYLIVYVDDVEIDVVPALSIESGEEA
ITAADRTPFHTKYVISHLDEKGRDEVRLLKRFLKGIGVYGAEIKVKGFSGYVTELLIIYY
GSFKEVLRNASKFRPPVRIELVRPKKEFDSPLIVPDPVDPKRNASSAVSLKSLATFALAS
KIYLEKPSMEFFFPSKPGRQTIKGDILLVKVKIEESTVEDIIWGQVWRNVEKLKTLISHE
GYRVIDISAWGDAENITIGIQLESKSIGEYYLNVGPYFYLHNVKNFIEENENVWIGEDGR
LYSIKRRRYTVEEIIKRNLSFKQKFTYELQWLTEEVDDPWINLFLRKTPSWLK
NT seq 1242 nt   +upstreamnt  +downstreamnt
atgacaatagaggaggaagttctaaagagaataaaacctagtaaagaagacgaggaaaag
ctaagggaaagagctcagattatattagatagactaaagggttataatgcagaaattgag
ggctcattcaggaaaggtacatggctaaaaggagatactgatatagatattttcgtattt
ttccctaaaagtgtgggtaaagaatatcttagagagaaggctttaaaggaattaatagaa
agattccgtgatttgaactataaaattgcctatgctgaacatccttatttgatagtgtac
gttgatgatgttgagatagatgtggttccggccttaagtatagagtctggagaagaggcg
attactgcagcggatagaaccccgtttcacactaagtatgtgatttctcatttagatgaa
aaagggagagacgaagtaagactattaaagagatttttgaaaggaatcggagtatatgga
gcagagattaaagttaaaggattttccggttatgttactgagcttttaataatctattat
ggttcattcaaggaagttcttagaaatgcatcaaagtttcgtccaccagttagaatagaa
ttagtgagaccaaagaaagaatttgattccccattaatcgttcccgatcccgtagatcct
aaaaggaatgcatcatcagccgtatcattaaaaagcttagcaactttcgctttagcttca
aaaatttatcttgagaaaccttctatggaattcttttttccctctaaaccgggtaggcaa
acaataaaaggtgatattcttctcgtgaaagtgaaaatcgaggaaagtactgtggaagat
ataatatggggacaagtatggagaaatgtggaaaagttaaaaacattaataagtcatgaa
ggctatagggttattgatatttctgcttggggggatgctgagaatataactattggtata
caattagaaagtaagagcattggtgagtattatctaaatgtaggtccttacttttatctg
cataatgtaaaaaatttcatagaagaaaatgagaatgtatggattggcgaagacggtagg
ctatactctattaagagaagaagatatacagtggaagaaataataaaaaggaatttatcc
tttaagcagaagtttacttatgaattacagtggcttactgaggaagtagatgacccttgg
ataaacttattcctaagaaaaacaccaagttggttaaagtga

DBGET integrated database retrieval system