KEGG   Sulfurisphaera tokodaii: STK_09640
Entry
STK_09640         CDS       T00062                                 
Name
(GenBank) AP endonuclease
  KO
K07457  endonuclease III related protein
Organism
sto  Sulfurisphaera tokodaii
Brite
KEGG Orthology (KO) [BR:sto00001]
 09190 Not Included in Pathway or Brite
  09192 Unclassified: genetic information processing
   99976 Replication and repair
    STK_09640
SSDB
Motif
Pfam: HhH-GPD HHH_2 DUF4332 HHH_5 RAP HHH STPPase_N Thioredoxin_13 EndIII_4Fe-2S HHH_8 IF2_N PPS_PS
Other DBs
NCBI-ProteinID: BAK54428
UniProt: F9VNS0
Position
complement(939196..939918)
AA seq 240 aa
MMRRAHTDEMKTSLRADKIIQKLIQEFEKNKELLRQAGWIVSDVNSFEWWDGLKTADEIL
ISSILVQMTKWEIVKKVIERLRQIGLNKLDKLANLSEEEIEELIKGVNFYKTKAKRLKKL
ATIVKEKGLENIVKNEKTLKEIEGIGDETAESLQLFVANLPVFPRSEYASRILSRILGEK
ISKKEAKILAESYLKDDVYKLKLFHAGIVTIGKIFCLSKPKCNSCIFKDLCAYYKHVVKS
NT seq 723 nt   +upstreamnt  +downstreamnt
gtgatgagacgagcgcacactgatgagatgaagacgtcactgcgtgctgataagataatt
caaaaacttatccaagaatttgagaagaataaagagctcttaagacaagctgggtggatt
gtaagtgatgtaaattcgtttgaatggtgggacggattaaagacagctgatgaaatttta
atttcatccatattagtacaaatgactaagtgggaaatagttaaaaaagtaattgaaaga
ctgagacaaataggtttaaataaactagataaattggctaatttatcagaagaagaaatt
gaagaacttattaaaggagttaatttttataagactaaggctaaaaggttaaagaaatta
gcaactatagttaaagagaaaggactagaaaatatagttaagaatgagaaaactttgaaa
gaaattgaaggaataggagacgagactgcagaatctttacaactttttgtagctaatctt
cctgtatttccaagatccgaatatgcttctaggattttaagcagaattttaggtgaaaaa
ataagcaaaaaagaagctaaaattttggctgagagttatttaaaagatgatgtatacaaa
cttaaactttttcatgctggaatagttaccattggtaaaattttttgtttaagtaaaccg
aagtgcaatagttgcatatttaaagatttgtgtgcatattataaacatgtggtgaaaagt
tga

DBGET integrated database retrieval system