KEGG   Sulfurisphaera tokodaii: STK_09800
Entry
STK_09800         CDS       T00062                                 
Name
(GenBank) putative TrmB family transcriptional regulator
Organism
sto  Sulfurisphaera tokodaii
SSDB
Motif
Pfam: TrmB MarR_2 HTH_11 MarR Fe_dep_repress TFIIE_alpha HTH_5 GntR HTH_24 HTH_27 HTH_Crp_2 Rrf2 SMC_ScpB RuvB_C HTH_DeoR Phage_rep_O HTH_20 HTH_36 DUF4423 HTH_54 PadR TBPIP RP-C Mnd1 FeoC HTH_10 HTH_41 SAMD1_WH MCM_C HTH_Tnp_Tc3_2_like
Other DBs
NCBI-ProteinID: BAB66001
UniProt: Q973B2
Position
complement(958772..959095)
AA seq 107 aa
MSEKLYDAKDVIRCCYKLSDTDIDCLFKLIELNKPVTSDELSQMMKVSKTTVENSLKKLI
DSGLVIRSKSEDKKIGRPKYYYSIVENIINKIREDLLNCSKKMQLSL
NT seq 324 nt   +upstreamnt  +downstreamnt
atgagtgaaaagttatatgatgcaaaagatgttataagatgttgctacaaactttcggat
actgatatagattgcttgtttaaacttattgaattaaataagccagtaacgtcagacgaa
ctttctcaaatgatgaaagtaagtaagactacagtagagaatagtttaaagaaactaatt
gattctggcttagtaataagaagtaagagtgaggataagaaaattggtagaccaaaatat
tattactctatagttgaaaatataattaataagataagagaagatttgttaaattgctcg
aagaaaatgcaattatcattgtag

DBGET integrated database retrieval system