KEGG   Sulfurisphaera tokodaii: STK_10110
Entry
STK_10110         CDS       T00062                                 

Definition
(GenBank) putative dihydropyrimidinase
  KO
K01464  dihydropyrimidinase [EC:3.5.2.2]
Organism
sto  Sulfurisphaera tokodaii
Pathway
sto00240  Pyrimidine metabolism
sto00410  beta-Alanine metabolism
sto00770  Pantothenate and CoA biosynthesis
sto01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:sto00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00240 Pyrimidine metabolism
    STK_10110
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    STK_10110
  09108 Metabolism of cofactors and vitamins
   00770 Pantothenate and CoA biosynthesis
    STK_10110
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:sto04147]
    STK_10110
Enzymes [BR:sto01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.2  In cyclic amides
    3.5.2.2  dihydropyrimidinase
     STK_10110
Exosome [BR:sto04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   STK_10110
SSDB
Motif
Pfam: Amidohydro_1 Amidohydro_3 Trp_dioxygenase Tektin
Other DBs
NCBI-ProteinID: BAK54439
UniProt: F9VNT1
Position
complement(993505..994806)
AA seq 433 aa
MIFKNARVITPKGIIETDFEVEEGKIKKIKKDIVGEGKDLSGYYVLPSVIDGHTHFNSRY
LGAKEIIPTADDYKSGSEITLAGGITSIINFIDPLNREVTEAVKDEIEKAKSTAGIDYSF
HLIIKRKDQINYLPEIIKMGIKSIKMFMAYKGSMQVDDETIYLVMKKAKELGVTVAIHAE
NGDVIEVLHNEYKDKKDAIYHALTRPVEVEEEAVNRASMLAYLTGAKTYIVHISSPTSLD
IISYWRKKGAKIFSETCPHYLLFDDSYYLRSDGNRFIMSPPLRRKELREELVRKLHMVNT
LGSDYSGFMSVYKDKALSYIEVPNGVSSTEFLVPTIMSFLFDNLITPEKVAEITSYNQIK
LYNLKEKGFDEGKDADFTVIKREEWIVKDWHGKMDYSIYEGVKFKAKVIQTYLRGELTFD
EDYKGSRGKLLKR
NT seq 1302 nt   +upstreamnt  +downstreamnt
atgatatttaaaaatgctagggtaataacacctaaaggaattattgaaacagattttgag
gttgaagaaggaaaaattaagaaaattaagaaggatatagtaggtgaaggaaaagactta
tctggttattatgtactgcctagtgtaattgatggacatacgcattttaactcaagatat
ttaggggctaaagaaataattcccacggcagatgattataaaagtggtagtgaaataaca
ttagcaggcggaataacttctataataaactttattgatcctttaaatagagaagtaaca
gaggcagttaaagatgagatagaaaaagctaaaagtactgctggtattgattattccttt
catttaattattaaaagaaaagatcagattaattatttaccagaaattattaaaatgggt
ataaaaagcataaaaatgttcatggcatataagggaagtatgcaagttgatgatgaaaca
atatatcttgtcatgaagaaagctaaagagttaggcgtaactgttgcaatccatgctgag
aacggcgatgttatagaggtcttacacaatgagtacaaagataagaaagatgcaatatat
catgcacttacaagaccagtagaagttgaggaagaagccgttaatagggcttctatgtta
gcttatttaactggcgctaaaacttatattgttcatatttcttctcctacatctctagat
ataatatcttattggagaaagaagggagctaaaattttcagcgagacttgtccacattac
cttttatttgacgatagttattatctaagatcagatggaaatagatttataatgtcacct
ccattgagaagaaaagaattaagagaagaacttgtaagaaaacttcacatggtaaatact
ttaggaagtgattactctggttttatgtctgtttataaggataaggcattaagctacatt
gaagttccaaatggtgtatcttcaacagaatttttagtccctacaattatgtcttttctt
tttgacaatttaataacaccagaaaaagttgctgaaataacttcttataaccagataaaa
ctttataacttaaaagaaaaaggattcgatgaaggaaaagatgccgattttacagttata
aagagagaagaatggattgtaaaagattggcacggtaagatggattactcaatttacgag
ggagtaaaattcaaagcaaaagttattcaaacttacttgagaggtgaattaacctttgat
gaggattataaaggtagtagaggaaaattattgaaaagataa

DBGET integrated database retrieval system