KEGG   Sulfurisphaera tokodaii: STK_10940
Entry
STK_10940         CDS       T00062                                 
Name
(GenBank) putative DNA glycosylase
  KO
K01247  DNA-3-methyladenine glycosylase II [EC:3.2.2.21]
Organism
sto  Sulfurisphaera tokodaii
Pathway
sto03410  Base excision repair
Brite
KEGG Orthology (KO) [BR:sto00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03410 Base excision repair
    STK_10940
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:sto03400]
    STK_10940
Enzymes [BR:sto01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.2  Hydrolysing N-glycosyl compounds
    3.2.2.21  DNA-3-methyladenine glycosylase II
     STK_10940
DNA repair and recombination proteins [BR:sto03400]
 Prokaryotic type
  SSBR (single strand breaks repair)
   BER (base exicision repair)
    DNA glycosylases
     STK_10940
SSDB
Motif
Pfam: HhH-GPD OGG_N Prophage_tail RuvA_C
Other DBs
NCBI-ProteinID: BAB66126
UniProt: Q972N8
Position
complement(1076379..1077227)
AA seq 282 aa
MRSVDIDDIVPPFNLLYTTWLLKRVKNNKIDEILPDKSYVRVFNRDVIVKVKQIGGIYNP
KLRVEIFSSKDDDEEGIIKTLRRVLGLDVDLTNFYNRALDNPYFSSLARKFIGAKPVVFP
TLLETVTNVISCQQISLNVCLTLVNKLAEKFGGKVIVDDKQINVFPTVEDLINSKPEELR
SLGYSSRKVEYILNAVNALKDKDSFESIKNLKGLGKWSINYILLRGLGRIDVIPTGDVGF
RNKAKRFLGIDNIEEILSSVKEYSGMIYYYLLLENLYHEGLL
NT seq 849 nt   +upstreamnt  +downstreamnt
atgcgtagcgtagatatagatgatatagtacctccttttaatctgctttatactacttgg
cttttaaagagagtgaaaaataacaagatagatgagatattacccgataaatcttatgtt
agagtatttaacagggacgttatagttaaagtaaagcaaataggcggaatttataaccct
aagctcagagttgagatcttcagcagtaaagatgatgatgaggaaggaataattaaaaca
ttgaggagagttttgggattagacgtagatttaacaaatttttataatagagccttagat
aatccgtatttttctagtttagcgagaaaatttatcggggctaaaccagtagtttttcct
actcttctagagactgttactaacgtaatttcttgtcagcagatatctcttaatgtctgc
ctcactttagtcaataaacttgccgaaaagttcggaggaaaagtcattgtagatgataag
cagattaacgtatttcccactgttgaggacttaattaattctaaaccagaagagcttaga
agtttaggttatagttcaagaaaagttgagtatatactgaacgcagtgaatgcattaaaa
gataaggacagttttgaatcaattaaaaacttaaagggtttaggtaagtggtcaataaac
tatatattgctaagagggctagggaggattgatgtaattcccacgggggatgtagggttt
agaaataaggctaaaagatttttaggtatagacaacattgaggaaatactttcttctgtt
aaggaatattccgggatgatttattattacttacttttggaaaatctttatcatgaagga
cttttatag

DBGET integrated database retrieval system