KEGG   Sulfurisphaera tokodaii: STK_11510
Entry
STK_11510         CDS       T00062                                 
Name
(GenBank) putative ATPase
Organism
sto  Sulfurisphaera tokodaii
SSDB
Motif
Pfam: AAA_5 AAA AAA_16 bpMoxR AAA_22 AAA_18 nSTAND3 Mg_chelatase IstB_IS21 AAA_19 TIP49 AAA_7 RuvB_N AAA_11 AAA_14 ResIII AAA_25 PhoH RNA_helicase AAA_24 AAA_33 Phage_holin_6_1 AAA_28 AAA_30 Zeta_toxin
Other DBs
NCBI-ProteinID: BAB66187
UniProt: Q972H9
Position
1149957..1151612
AA seq 551 aa
MVIFSVYGDWLTVRDAFKNLLGFSEEAVSTFLDYVQNGKFIPCLFIGSKEHWIESIRYSF
EGEIGYTLWGSADKSSISGILSRYQMVYLNTDKSRYIPDNNKILIAMLYMTGSGIIGFGV
VTDVEMDAIRNFKGWKEVSGKFWVLRFRIKVFWLHESIRKNKDINAWTGESYELKGTNSQ
ANMCYSQENNDAINSFKSFILSKKDEIKPTLDLYLSLLGSKPKEVEENKKEVICKGAGQI
NVNDLYLPPNALDLILSSVKRTNVLLVGPPGTGKTSLAVRVAKSLTGNDECYEVATANSL
WFRRNLVGGESIRGGSVIWKSGLFIQAYVNAYKVKEGNYFLIIDEINRADVDKAFGELIT
IFSSPSPDEWSIPRSLIDEIKSYGDNVDSTAKEFLRIYEDLKKENRENEPLRKMRIIATM
NLVDARNLFYIGDALARRFVIIKFDYPEGTEDLDKLIDRYNLRDDEKNEIRNLIGCLRAK
LKKDEKDALVKFNVSPASIKTALDIYSSLENKGIDKFIEVLESTLGTLDQKNISRVKSKI
EECRKGENRKI
NT seq 1656 nt   +upstreamnt  +downstreamnt
gtggtaattttttccgtgtatggggactggcttacagtaagggacgcgtttaagaacttg
ttaggcttttctgaagaagcagttagcacattcctagattatgtgcaaaatggaaaattt
ataccttgtcttttcataggttccaaagagcactggatagagtctataagatattctttt
gagggagaaataggctatacactttggggatctgcagataagtcatcaatttctggtatt
ttaagcagatatcagatggtatatttaaatactgataagagcagatatattccagataat
aacaaaattcttattgcaatgctatatatgacaggttctggaataataggattcggagta
gtaactgacgtggaaatggatgctattagaaactttaagggatggaaagaagtttctggt
aaattctgggtactcagatttagaataaaagtcttttggcttcatgagagtataaggaaa
aataaggacataaatgcatggactggagaaagctatgaattaaaaggaacaaattcgcag
gcaaatatgtgctacagccaagagaataacgatgctataaatagcttcaagagttttatt
ttatcaaagaaggacgagatcaaacccactcttgacctttatctaagcttgctaggcagt
aaacctaaagaagttgaggaaaataaaaaagaagtaatatgtaagggagcaggacaaata
aatgtgaatgacctatatcttcccccaaacgctctggatttaattttaagttcagtaaag
agaactaacgtgcttttagtaggccctccaggtactggtaagacaagcttggctgtaaga
gtagctaagtcacttactgggaatgacgagtgttacgaagtcgccactgcgaattcgtta
tggtttaggaggaacttagtaggtggagaaagcattagaggagggagtgtaatatggaag
agcggtctctttatccaagcttatgtaaatgcatataaagtgaaggagggaaactatttc
cttattatagatgaaataaatagggctgatgtggataaagccttcggagagttaataaca
atattctcaagcccttctccagatgaatggtcaattcccagatcacttatagacgaaata
aaaagctatggagataatgtagatagtactgcaaaggaatttctcagaatatatgaagat
ctgaaaaaggagaatagggaaaacgagccattgagaaaaatgcgaattatcgctacaatg
aacctggtagatgctagaaacctcttttatataggagatgcactagctagaagatttgta
attattaaatttgattatccagaggggacagaagatctagataaactcattgacaggtat
aacctcagagatgatgaaaagaatgagataagaaacttaataggatgtctaagagccaaa
ctgaaaaaagacgaaaaggatgcgttagtgaaatttaacgtatctccagcaagtataaag
acagcacttgacatttactcttctttagagaacaagggaatagataagttcatagaagtg
ctcgagtcaacccttggtactttagatcaaaagaatattagtagagttaaaagtaaaata
gaagaatgcagaaaaggcgaaaatcgtaaaatctaa

DBGET integrated database retrieval system