KEGG   Sulfurisphaera tokodaii: STK_11530
Entry
STK_11530         CDS       T00062                                 
Name
(GenBank) putative ATPase
Organism
sto  Sulfurisphaera tokodaii
SSDB
Motif
Pfam: AAA_5 AAA IstB_IS21 nSTAND3 AAA_19 AAA_28 Mg_chelatase RuvB_N bpMoxR AAA_16 PhoH AAA_22 GapR_DNA-bd ResIII AAA_11 AAA_18 TIP49 AAA_33 AAA_30 Parvo_NS1 AAA_7 AAA_25 AAA_24 NACHT AAA_29
Other DBs
NCBI-ProteinID: BAB66189
UniProt: Q972H7
Position
1153684..1155735
AA seq 683 aa
MTDLSELLLKYFLTSLNLIEVEPRGNAEETNNKEVMKMLNEGYIPLFSAEKIKFIKNLSP
VYAQLKDMADAIFNELNIRTELPASYKVAIALQLSILETWRKVIVEKAMLDERIVIDEEN
KLDISPYALLLLYRFIAISKFMCTGNEIVKLFSKVLETQKEDNAIVDIKRLEEYIEKKRQ
DRNEQRRAYTMYNTLFAPLILSYALSGASLLKYYRGLTQNQLSYTSTTLMEILESYFFRV
IYDDNRSTLISLAKELVDYFSVLHEIVSNKELKSIIKEGSLYSYVLSKANERGITDMSKI
SVIWGLINDAVIAALVSLELYDNEELKTAYRNLVGDITIYEYVIKYPQKNKAQQIQAQYS
QISTVLCNKGSQIKVDDLYLPQNNSLNIILSSVKNGNVLFIGPPGTGKTTLAIRIAEGIT
GNRECYQIVTANALWFRRHLIGGESLEKETVVWKSGLLLQAYVKASKIKDGYYFIIIDEL
NRADIDKAFGELFTIFSSPSADDWSMPNSIYEEIERYGDNIDEIAREFKRVYSKLKSEGR
ENEPLRKIRVIGTLNLIDARNLFYVGDALTRRFVTIQFEYPKDVEDLEKFFTYYHLNENE
KQEIRELVMELRQEFGRSKTVKFNISPASLRIALKLYSSLEERDINAFINILKSTLGTLN
QDVIRMFDNIVEEYEKKKKGIIS
NT seq 2052 nt   +upstreamnt  +downstreamnt
atgacagatcttagtgagttattacttaaatatttccttacttccttaaatctcatagaa
gttgagcctagaggtaatgcagaagaaactaacaataaagaggtaatgaagatgttgaat
gagggatatataccgcttttttcggctgaaaaaataaagttcataaagaatctttctcca
gtttatgcacaactcaaagatatggctgatgcaatattcaatgagctaaacataaggact
gaacttccggcttcttacaaagttgcaattgcattacaactctccatattggagacgtgg
cggaaagtgatagtagaaaaggcaatgttagacgaaagaattgttatagacgaggaaaat
aaactggatatctccccttatgctttactactgttatatagattcattgcaatttcgaaa
tttatgtgtactggtaacgaaatagtgaagctttttagcaaagtcttggaaacacagaaa
gaagataatgctattgtggatattaaaaggcttgaggagtatatagagaagaagaggcaa
gacagaaacgaacaaagaagggcatatacaatgtataatacgctttttgctccattaata
ctttcatatgctttaagcggtgcgagtttacttaaatactataggggactaacacagaat
cagctatcttatacctctacgacactcatggaaattctagagtcttatttctttagagta
atttacgatgataatcgctccactttaatttctctagctaaagaattagtagactatttt
tcagttttacacgaaattgtttctaacaaggaactaaaatctattataaaagaaggttcc
ctatattcttacgtgttgtctaaggctaatgaacgtggtattactgatatgagtaaaatt
tccgtaatatggggtttaataaatgatgctgtgattgctgcattagtctctttagagctt
tacgataatgaagaacttaaaactgcttataggaacttagttggagatatcactatttat
gaatatgtaattaaatatccacagaaaaacaaagctcaacaaatacaagctcaatattct
caaatctctacagtcctatgtaataagggttcacagatcaaggttgacgacctatatctt
ccccaaaataattccctcaatattatattaagttcggtaaaaaacgggaacgtgttgttc
ataggtcctccgggaactggaaagactactttagcaataagaatagctgaagggattact
ggaaatagagagtgttaccaaatagttaccgcaaatgcattatggttcagaaggcactta
atcggtggggaaagcctagagaaagaaaccgttgtttggaagagcggtttgctcctacaa
gcttacgtaaaagcatctaagataaaagacggatattattttataattatagatgagctg
aatagagccgacattgataaagcttttggggagctgtttacaatattctccagcccgtca
gcagatgactggtcaatgcctaacagtatttacgaggaaattgaaagatatggagataac
attgatgaaattgcaagagaatttaagagagtatattcaaagttaaagagtgagggaaga
gagaacgaaccgttaagaaaaataagggtaataggaacgctcaatttgatagatgccaga
aacctcttctatgtaggagatgcgttaactaggaggtttgttacaatccaatttgaatat
ccaaaagatgtggaagatctggagaagttctttacctattatcaccttaatgagaatgaa
aaacaagagattagggagctagtaatggaacttagacaagaattcggtagaagtaagacc
gttaagttcaacatttcacctgcaagtttaaggatagcattaaagctttactcctctctt
gaggagagggatataaacgcatttataaacatcttgaaaagtacactaggaacactgaat
caggatgtaattaggatgtttgataatattgtagaggagtatgaaaagaagaaaaaaggt
attattagttaa

DBGET integrated database retrieval system