KEGG   Sulfurisphaera tokodaii: STK_12180
Entry
STK_12180         CDS       T00062                                 
Symbol
serA
Name
(GenBank) D-3-phosphoglycerate dehydrogenase
  KO
K00058  D-3-phosphoglycerate dehydrogenase / 2-oxoglutarate reductase [EC:1.1.1.95 1.1.1.399]
Organism
sto  Sulfurisphaera tokodaii
Pathway
sto00260  Glycine, serine and threonine metabolism
sto00270  Cysteine and methionine metabolism
sto00680  Methane metabolism
sto01100  Metabolic pathways
sto01110  Biosynthesis of secondary metabolites
sto01120  Microbial metabolism in diverse environments
sto01200  Carbon metabolism
sto01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:sto00001]
 09100 Metabolism
  09102 Energy metabolism
   00680 Methane metabolism
    STK_12180 (serA)
  09105 Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    STK_12180 (serA)
   00270 Cysteine and methionine metabolism
    STK_12180 (serA)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:sto04147]
    STK_12180 (serA)
Enzymes [BR:sto01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.95  phosphoglycerate dehydrogenase
     STK_12180 (serA)
    1.1.1.399  2-oxoglutarate reductase
     STK_12180 (serA)
Exosome [BR:sto04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   STK_12180 (serA)
SSDB
Motif
Pfam: 2-Hacid_dh_C 2-Hacid_dh AdoHcyase_NAD NAD_binding_2 IlvN Rossmann-like F420_oxidored VirK Ub-RnfH UDPG_MGDP_dh_N
Other DBs
NCBI-ProteinID: BAB66260
UniProt: Q972A9
Structure
Position
complement(1220650..1221591)
AA seq 313 aa
MAIYTVKALITDPIDEILIKTLREKGIQVDYMPEISKEELLNIIGNYDIIVVRSRTKVTK
DVIEKGKKLKIIARAGIGLDNIDTEEAEKRNIKVVYAPGASTDSAVELTIGLMIAAARKM
YTSMALAKSGIFKKIEGLELAGKTIGIVGFGRIGTKVGIIANAMGMKVLAYDILDIREKA
EKINAKAVSLEELLKNSDVISLHVTVSKDAKPIIDYPQFELMKDNVIIVNTSRAVAVNGK
ALLDYIKKGKVYAYATDVFWNEPPKEEWELELLKHERVIVTTHIGAQTKEAQKRVAEMTT
QNLLNAMKELGMI
NT seq 942 nt   +upstreamnt  +downstreamnt
atggctatctatactgttaaggccttaataacagatcctatagatgaaattctaattaaa
actttgagagaaaaaggaattcaagtagattatatgccagaaataagcaaagaagaatta
cttaatataatcggtaattatgatattatagtagtgagaagtagaactaaagtgactaaa
gatgttatagaaaaaggcaaaaaactaaaaattattgctagggctggaattggacttgat
aatatagatactgaagaggctgaaaaaagaaatataaaagttgtttatgctcctggtgcc
tctactgattctgcagtagaattaactattggactcatgatagcggcagcaaggaaaatg
tacacttctatggctttagcaaaatctggtatatttaaaaaaattgagggactagaatta
gcgggaaaaactatcgggattgtaggtttcggaagaattggtactaaggttggaataata
gcaaatgcaatgggaatgaaagtattagcttacgatattttagatataagagagaaagcc
gagaaaataaacgcaaaagcagtaagtttagaggaattattaaaaaattctgatgtaata
agtcttcatgttactgtgagtaaagatgcaaaaccaataattgactatccgcaatttgaa
ctaatgaaagataatgttataattgtaaacaccagtagagcagttgccgttaatggtaaa
gcacttttagattatattaagaaaggaaaagtttatgcttatgctactgatgtattttgg
aatgaaccaccaaaggaagaatgggaattagaattattaaaacatgaaagagttattgtt
acaactcatattggtgctcaaaccaaagaggctcaaaaaagggtagcagaaatgactact
caaaacttgcttaacgctatgaaagagttagggatgatataa

DBGET integrated database retrieval system