KEGG   Sulfurisphaera tokodaii: STK_12190
Entry
STK_12190         CDS       T00062                                 
Symbol
ogg
Name
(GenBank) probable 8-oxoguanine DNA glycosylase/DNA lyase
  KO
K03653  N-glycosylase/DNA lyase [EC:3.2.2.- 4.2.99.18]
Organism
sto  Sulfurisphaera tokodaii
Brite
KEGG Orthology (KO) [BR:sto00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    STK_12190 (ogg)
Enzymes [BR:sto01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.99  Other carbon-oxygen lyases
    4.2.99.18  DNA-(apurinic or apyrimidinic site) lyase
     STK_12190 (ogg)
SSDB
Motif
Pfam: HhH-GPD DUF6095
Other DBs
NCBI-ProteinID: BAB66261
UniProt: Q972A8
Position
complement(1221782..1222396)
AA seq 204 aa
MLRELVKNKKLRARVLERAEEFKLNNRAEENVWFRELILCILTSNSSFISAYKALNYIMD
EIFSLSEDQMSKRLRLAGYRFYNLKAKYIANARKLYGNLKTKIKPIADYSQEEARQYIIN
NIDGLGLKESSHFLRNVGYFDLAIIDRHVLHFLNEIGTSNLKIKNKKDYYLAESILKSIS
INLGIQVGLLDLYIFFKQTNTIVK
NT seq 615 nt   +upstreamnt  +downstreamnt
gtgctaagagagctagtaaaaaacaaaaagctaagagcaagagtgctagaaagagcagaa
gagtttaaattaaataacagagctgaagagaatgtttggtttagagaattaattttatgt
attttaacctcaaatagttcttttatatctgcgtataaagctctaaattatataatggac
gaaattttttctctaagtgaagatcagatgagcaaaagacttagattagccggttataga
ttttacaatttaaaagcaaaatatatagcaaatgcaagaaaattatatggaaatttgaaa
acaaaaataaaacctattgctgattattcacaagaagaagccaggcagtatatcataaat
aacattgacggattaggattgaaagaatctagccatttcttgagaaacgtaggctatttc
gatttagcaattatagatagacatgtgctacatttccttaacgaaattggcactagtaat
ttaaaaattaaaaataaaaaggactattatttagctgaaagtatacttaaatcaattagt
attaatcttggtattcaagttggactacttgatttgtatatattttttaaacaaaccaat
acaatcgtaaagtag

DBGET integrated database retrieval system