KEGG   Sulfurisphaera tokodaii: STK_12900
Entry
STK_12900         CDS       T00062                                 
Symbol
rgy
Name
(GenBank) reverse gyrase
  KO
K03170  reverse gyrase [EC:5.6.2.2 5.6.2.-]
Organism
sto  Sulfurisphaera tokodaii
Brite
KEGG Orthology (KO) [BR:sto00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03032 DNA replication proteins [BR:sto03032]
    STK_12900 (rgy)
Enzymes [BR:sto01000]
 5. Isomerases
  5.6  Isomerases altering macromolecular conformation
   5.6.2  Enzymes altering nucleic acid conformation
    5.6.2.2  DNA topoisomerase (ATP-hydrolysing)
     STK_12900 (rgy)
DNA replication proteins [BR:sto03032]
 Prokaryotic type
  DNA Topoisomerases
   STK_12900 (rgy)
SSDB
Motif
Pfam: Topoisom_bac Toprim zf_Rg DEAD ResIII zf-ribbon_3 Toprim_4 AAA_22 zinc_ribbon_9 DZR Zn-ribbon_8 zinc_ribbon_15 BRCT FYVE zf-C3HC4_3
Other DBs
NCBI-ProteinID: BAK54510
UniProt: Q971T7
Position
1284001..1287471
AA seq 1156 aa
MLKVYYTFGCPNCGGPIDDEHLLAGVPCSKCLPGRVENLDYRVIYDLLVKNSTLKGYAEY
FYDNETFEEIVRIFKRVIGNEPWNLQKYWIKRLAKSESFSLSAPTGLGKTTTLLVYSLFF
SNTTLYVVPTNSLKDQICERLRNMGAKVSCNDVKEEYINVATFNRILRHYDNYVSLQPKL
VIVDDSDMILKSGKTTEVMAKILGISEEIFQYAISLIRLKRILKFNEDDKELKNKIVELE
YKIGSWKPFVQFLVASATLRPKGIKQQALRTLIGFEPSTIQTYLRNIADLYYQGVDIEAI
LDKISDNGGLLLVSKEYGREKMLELKEIIEKRGYSTGLAISGRKFLNKFTEGKIDYLIGS
ASYYGVAVRGLDEPKRLKYVIFYGIPKIRLNLTDALNNPSLIVKIGELLNIDVKDIRRKL
LFLSPPEFQILRYSLMKDEELSGKLKDIKVNLINIKEKIWDVLKSDNIKKLKADTFLVTE
NNGKYYVYIPDTVTYIQASGRSSRIISNGLTFGISIVLVDNIDLLDILSQKLKKIIPNFM
FKNINEVDIRELKSLAVSSREVSTSQKKKINIKTILLIVESPTKAKTIARLFGRPSRREV
HGIPVYETIILVNDEILITNIIATKGHITDLTTENIGYYGVEVGNNEFNAYYSPIYKCYN
CGKTFTIKSNTCPYCGSVFISSSEKVVSALRKLSTEVDEIYIASDPDQEGEKIAYDVAML
ISPYNKNIYRIKYHEITRNGILNAILNKGKINMNLVKSQIVRRIEDRWIGFELSLALKSM
FYERNHGSGRVQGPVLSWIVERTKEYKKNYGWILYIKLGDYAIKKFFRIKEEANKFIEKL
NIKINLISERKEIQNPLPPFTTDSLLMDAYDKLGIGSQIVMKIAQDLFESGLITYHRTDS
THVSALGISIAKEYLESKNLNDSFSGRSWGNEGTHEAIRPTSSMDTESLIKDIEDNPNKY
FIKFTKYHLRIYDLIFRRFIASQMKPAEVTYSKFEIFINGEKLEVELPTKISGGFSIIYP
LKTYVVSEKYSTYLTKGSIIPLFTYAEIIKNMKEKEIGRPSTYAKTISALIRHGYVVESK
RKALLIATNKGIKAYEFLSSCCSDLISENRTKLLLQKIDKIANGDVNVDYVLEDLHKEIT
QISGKLVNSLKLDTNV
NT seq 3471 nt   +upstreamnt  +downstreamnt
atgctgaaggtttactatacgtttggttgtcctaactgtggtggtcctatcgatgatgaa
catttactagccggagttccatgtagtaaatgtttacctggaagagtagaaaatttagat
tacagagtaatctatgatttgttagttaaaaattctacgttgaaaggttatgcagaatac
ttttatgataatgaaacttttgaagaaatagttaggatatttaaacgggtaataggaaat
gagccctggaatttgcaaaaatattggataaaaagattagccaagagcgagagtttttca
ctctcagcgcctactggattagggaaaaccacaactcttctagtatattcattattcttt
agtaatacgactttatacgtagttccaaccaactctttaaaagatcagatatgcgaacga
ttaagaaacatgggggccaaggttagctgtaatgatgttaaagaagaatacataaatgtt
gcaaccttcaatagaatattaaggcattatgataactatgtcagtctacaaccaaagtta
gtcatagttgatgattctgatatgattctaaaaagtggtaaaacgacagaggtaatggct
aaaatactagggatatcagaggaaattttccagtatgctatcagtttaataagattgaaa
agaattcttaaatttaacgaagatgataaagagttaaaaaataaaatagtagaactagaa
tataaaattggtagctggaagcctttcgttcagtttctagtagctagtgctacgttaagg
ccaaagggtataaaacaacaagccttaagaacattaataggatttgaaccctctactatt
cagacttatttgagaaacatagccgatttatattatcaaggagtagatatagaggcaatt
ttagataaaatttcagataatggtggactattattagtttccaaagaatatggaagagaa
aaaatgttagaattaaaggaaatcatagaaaaacgaggatattctactggtcttgctata
tctggaagaaaattcctcaataaatttactgaaggtaaaattgattacttgattggttct
gccagttattatggagtagcagtaagaggtcttgatgagcctaaaaggctaaaatatgta
atcttctatggcatacctaaaattaggttaaatttaaccgatgcactaaacaatccatca
cttatagtaaaaataggagaattacttaatatagatgtaaaagatatcagaagaaagcta
ctattcctaagtccaccagaatttcaaatattgaggtatagtttaatgaaagatgaagag
ctcagcggaaaactaaaagatattaaagttaatctaataaatattaaagaaaaaatatgg
gatgttttaaagagtgataatattaaaaaactgaaagcagatacatttttagtaactgaa
aataatggtaaatactacgtatatatacccgatactgtcacctatattcaggcttctggt
agaagtagtagaataattagtaacggtttaacatttggtattagtatagttctagtggat
aatattgatttgttagatattctttcacaaaaactaaagaaaattataccaaattttatg
tttaaaaatataaatgaagtagatataagagaattaaaatccttggctgtctcaagtaga
gaagtatctacgtcccagaaaaagaaaataaatattaagactatattgctaatagtagaa
tctcctacgaaagctaagactatagcaagactatttggaagacctagtagaagagaagtt
catggcatacctgtctatgaaactataattttagttaacgacgagattttaataaccaat
attatagctactaaaggccatataaccgacttaactacagaaaatataggttactatggc
gttgaagtcggtaataatgaatttaacgcgtactattcgccaatttataaatgctataat
tgtggaaaaacgtttacaatcaagtctaacacatgtccttactgcgggtctgtatttatc
tcatcatcagagaaagttgtttcagcattaagaaagttaagcacagaagtagatgaaata
tacatagcatctgacccagatcaagaaggagaaaagattgcatatgatgtagctatgtta
attagtccctataataagaatatttatagaattaaatatcatgaaattactagaaatgga
attttaaatgctatattaaataaaggaaaaattaatatgaatctagtaaaatcacaaata
gtaagaagaatagaagatagatggatcggttttgagctgagcttggcattaaaatctatg
ttttatgaaaggaatcatggttcaggtagagtgcaagggcctgtgttaagttggattgta
gagagaacaaaagagtataagaagaattatggttggattctttatataaagttaggagat
tacgctataaagaaattctttaggatcaaagaggaagcaaataaattcatagaaaaatta
aatattaaaatcaatttaatatctgaaagaaaggaaatacaaaatcctttgccaccattc
actacagattcgttattgatggatgcatatgataaactagggattggttcccaaatagta
atgaaaattgcacaagacctatttgaatctggtttaataacctatcataggactgatagt
actcatgtatctgcattaggtatatcaattgcgaaagaatatcttgaatctaaaaactta
aatgatagctttagtggtagatcatggggaaatgaaggcacacatgaagcgattagacca
acatcttcaatggatacagagagtcttattaaagatattgaggataatcctaataaatat
ttcataaagttcactaaatatcatttaagaatatatgatttaatatttagaagatttata
gcaagtcaaatgaagccagccgaggttacttatagcaaatttgaaatatttataaatggt
gaaaaacttgaggtagagttacctacaaaaataagtggtggattttctataatttatcct
ttaaaaacttatgtagtaagtgagaaatattccacatatttgactaaaggatctataata
ccattatttacatatgctgagataataaagaatatgaaagaaaaagaaataggaagacct
agcacttacgctaagactatttctgcacttataaggcatggatatgtagtagaaagcaaa
agaaaggcattgcttatagctactaacaaaggcataaaggcttatgaatttttatcttca
tgttgtagtgacttaattagtgaaaataggacaaaattgttattacagaaaatagataaa
atagcaaatggtgatgtaaatgtcgactatgtactagaagatttacacaaggagattaca
caaatatctggaaaattagtaaactctcttaagcttgatactaatgtatga

DBGET integrated database retrieval system