KEGG   Sulfurisphaera tokodaii: STK_12980
Entry
STK_12980         CDS       T00062                                 
Name
(GenBank) putative pseudouridine synthase
  KO
K07583  tRNA pseudouridine synthase 10 [EC:5.4.99.25]
Organism
sto  Sulfurisphaera tokodaii
Brite
KEGG Orthology (KO) [BR:sto00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:sto03016]
    STK_12980
Enzymes [BR:sto01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.99  Transferring other groups
    5.4.99.25  tRNA pseudouridine55 synthase
     STK_12980
Transfer RNA biogenesis [BR:sto03016]
 Eukaryotic type
  tRNA modification factors
   Psudouridine synthases
    STK_12980
SSDB
Other DBs
NCBI-ProteinID: BAK54514
UniProt: F9VP06
Position
1298209..1299276
AA seq 355 aa
MKTEILSKSLELLSKYPLCDSCLGRCFARLSLGHSNEERGKAIKILLLMEIDKAIKEHKI
EDLSQIKEVLYNMGEISLTLYKNYFNDEFQNRSCYICDNRINEFKENFLKKALEKIGNNK
TFVLGVKLTDELKNREEKFMVENQLFYYESIKNEIKRDVGKKLANMGFIPEFDNPQVELV
YDMEYDTVIIFTKSKKYLAFYNRLSRGIPISSWVSKGGESLESLLSTQVVAPYSEASEYR
IIDDYPLIIENITEKEINLQGFHITVVSKIAGKELSTIFTIKPTRRLYRVTVYSDEEIKE
GIKIYDKIYDIFIEAKDFKELREKIKNYQLISIDLISTVGKSKLVADTYIKKNFS
NT seq 1068 nt   +upstreamnt  +downstreamnt
ttgaagacagaaattctaagtaaatcactagagttattatctaagtatcctctttgtgat
agttgtctaggaagatgttttgcaaggctcagtttaggtcatagtaatgaagaaagaggt
aaggcaataaagatattattattaatggaaatagataaggcaataaaagagcataaaata
gaagatttatcacaaataaaagaagttctatataatatgggagaaataagccttacttta
tataagaattattttaatgacgagtttcaaaatagaagttgttacatttgtgacaataga
ataaatgaatttaaagaaaatttccttaagaaagcattagaaaagataggaaataataag
acttttgtattaggtgttaaactcactgatgaattaaagaatagagaagaaaaatttatg
gtggaaaatcaattattctattatgaaagtataaaaaatgaaataaaaagagacgtagga
aaaaaattggctaatatgggttttataccagaatttgataatcctcaagtagaacttgtc
tatgatatggaatatgatactgtaataatatttactaagtctaaaaagtacttagcattt
tataatagacttagtagaggtatacctatatctagttgggtttctaaaggaggagaatct
ttagagagtctattatctacgcaagttgttgctccttattctgaggcttcagagtacaga
ataattgatgactatccgcttataatagaaaatataactgagaaagagataaacttgcaa
ggattccatattactgtagtatcaaaaattgcgggaaaagagctatcaacaatttttact
ataaagcctactagacgtctatatagagtaacagtttattcagatgaggaaattaaggag
ggaattaaaatttatgataaaatttatgatatatttatagaggcaaaagattttaaagaa
ctaagagagaagataaaaaattaccagcttatttccatagatttaatatctactgtaggc
aaaagtaaactagtagccgacacttatattaaaaagaatttttcataa

DBGET integrated database retrieval system