KEGG   Sulfurisphaera tokodaii: STK_13440
Entry
STK_13440         CDS       T00062                                 
Name
(GenBank) hypothetical protein
Organism
sto  Sulfurisphaera tokodaii
SSDB
Motif
Pfam: YpjP Sec6 RPT Cut8 COG2 FMP23 DUF2408
Other DBs
NCBI-ProteinID: BAB66403
UniProt: Q971L7
Position
1352547..1352864
AA seq 105 aa
MTETTSILQQYLEKAYALYGKAVRLVAVDRAARRIMKEVNELISALEEYINYNIEYDAVE
VSNKLTYYEKQLKMIEEKKDSMLLRSFREMTRKQNGKLGSLPQED
NT seq 318 nt   +upstreamnt  +downstreamnt
atgactgagactacttctattttacagcagtacttagagaaagcttatgcattatatgga
aaagctgtaaggttagtagcagtagacagagccgcaaggaggataatgaaggaggttaac
gaattgatcagtgcactggaagaatacataaattacaatattgaatatgacgctgttgag
gtttctaacaagcttacatattacgaaaagcagcttaagatgattgaagagaaaaaagat
tctatgctattgaggagttttagggaaatgactagaaaacaaaacggtaaactggggagt
ttaccgcaagaggactga

DBGET integrated database retrieval system