KEGG   Sulfurisphaera tokodaii: STK_13970
Entry
STK_13970         CDS       T00062                                 
Symbol
upsE
Name
(GenBank) ATPase UpsE
  KO
K07332  archaeal flagellar protein FlaI
Organism
sto  Sulfurisphaera tokodaii
Brite
KEGG Orthology (KO) [BR:sto00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:sto02044]
    STK_13970 (upsE)
   02035 Bacterial motility proteins [BR:sto02035]
    STK_13970 (upsE)
Secretion system [BR:sto02044]
 Type II secretion system
  Archaeal flagellar protein
   STK_13970 (upsE)
Bacterial motility proteins [BR:sto02035]
 Flagellar system
  Archaeal flagellar assembly proteins
   STK_13970 (upsE)
SSDB
Motif
Pfam: T2SSE ABC_tran AAA_29 AAA_23 AAA_16 AAA_22 cobW SMC_N nSTAND1 nSTAND3 AAA_21 Adeno_IVa2 ResIII AAA_7 RNA12 AAA_5 AAA_14 AAA
Other DBs
NCBI-ProteinID: BAB66464
UniProt: Q971F6
Position
1402369..1403793
AA seq 474 aa
MTTILHEYYVGPAKIRILRDDNGICKYIVEEPQLTEYEEEIKNSILSEIMYTNLKNIEDF
VISKLKDKGFKDDVIEKILYHVKKSMLYDNITPLMLDQEIEEIECRGFGYPITVIHRSFS
ECIRLFTNIIPKNEDDIIKIVEKMANKANKSINIAKPYVEFSLPEGHRVAATLGSEISLP
GSTFDIRKFPSKPLSIIQMITNGMLNELIASYLWFIMEYKPFIMILGPTGSGKTSLLTAI
LNLINPSYKILTIEDTPEINITSDNWVRFISRSTLAGNYDVTLSDLAKLALRYRPDYLVV
GEVRGKEIEALIHAAASGHGSLTTFHGSRPIDAITRITDLLSSDLSKLFLQTIWSFIIVS
RRKEGNKSIRSIIGIYETLIDKNKIKFKKVIEWSFIKNEFIPLDINSLSKRSYRLKWISK
VYGLSIEEIRQEIERRMNFLTTLKNEKVIDFVDVSYKIRKFYEVGEASAKNVAQ
NT seq 1425 nt   +upstreamnt  +downstreamnt
atgacaactattcttcatgagtattatgtaggtccagctaaaataagaatattacgtgat
gataatggaatttgtaaatacattgttgaagaaccacaactaacagaatacgaagaagaa
ataaagaattccatattatctgaaattatgtatacaaatttaaaaaacatagaagatttt
gtaattagtaagttaaaagataaaggatttaaagatgatgtaattgaaaaaattctttat
catgttaaaaaaagcatgttatatgataatataactccattaatgttagaccaagaaatt
gaagaaattgaatgtagaggttttggttatcctataactgtcattcacagatctttttcg
gaatgtattagacttttcacgaatataattccaaaaaacgaggatgatattataaaaatt
gttgagaaaatggcaaataaggccaataaaagtattaatatagctaaaccttatgttgag
ttttcactcccagaaggacatagagtagctgctactttaggcagtgaaatatcattacct
ggttctacattcgatatacgtaagtttccgtctaaacctctcagtattatccagatgatc
actaatggtatgttaaatgagctaatagcatcttatttatggttcataatggaatataaa
ccatttataatgatcttgggacctactggttctggtaagacttctctcttaacagctatt
cttaatttaattaatccaagctataagattttaactattgaagatactccagaaataaat
ataaccagtgacaattgggttaggtttataagtagatcaactttggctggtaactatgat
gtaactttaagtgatttagctaaattagctctacgatataggcccgattatttagtggtt
ggagaagttagaggaaaagagatagaagctctaattcatgctgcagcatctggccatggt
tctttaactacttttcatggttcaagacctatagacgctattactagaataactgattta
ctatcttctgatttgtctaaactttttttgcaaactatatggtccttcataatagtaagt
agaagaaaagaaggaaacaaaagtattcgtagtataatcggaatatatgagactttaata
gataaaaataaaattaaatttaaaaaagtaattgaatggtcgtttataaaaaatgaattt
attcctctagatataaattctttatcaaagagatcatatagactaaaatggattagtaaa
gtttatgggttatccattgaagagataagacaagaaatagaaagaaggatgaatttcctt
actactttaaaaaacgagaaagttattgattttgttgatgtttcttataagataagaaag
ttttatgaagtaggtgaggctagtgctaagaatgttgctcaataa

DBGET integrated database retrieval system