KEGG   Sulfurisphaera tokodaii: STK_14010
Entry
STK_14010         CDS       T00062                                 
Symbol
nth
Name
(GenBank) DNA glycosylase/AP lyase
  KO
K10773  endonuclease III [EC:3.2.2.- 4.2.99.18]
Organism
sto  Sulfurisphaera tokodaii
Pathway
sto03410  Base excision repair
Brite
KEGG Orthology (KO) [BR:sto00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03410 Base excision repair
    STK_14010 (nth)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:sto03400]
    STK_14010 (nth)
Enzymes [BR:sto01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.99  Other carbon-oxygen lyases
    4.2.99.18  DNA-(apurinic or apyrimidinic site) lyase
     STK_14010 (nth)
DNA repair and recombination proteins [BR:sto03400]
 Eukaryotic type
  SSBR (single strand breaks repair)
   BER (base exicision repair)
    DNA glycosylases
     STK_14010 (nth)
 Prokaryotic type
     STK_14010 (nth)
SSDB
Motif
Pfam: HhH-GPD HHH EndIII_4Fe-2S NCD1
Other DBs
NCBI-ProteinID: BAK54558
UniProt: F9VP50
Position
1406436..1407110
AA seq 224 aa
MCNPKELLNKLSNVYSIDPKDFVAYYVCKNTSDVFKTFVATILSQNSTDKATYVAYNNLE
NKIGVTVDKILSISEDELKEVIKIVGLSNSKARYIKNIALFFKRNKIDELTRLPCDKLRE
LFLTVDGIGEKTADVVLVNCFKCKFFPVDTHIKRVMSRLGILGSKPQYKEIADFFISSLN
EDELLELHQLLILHGRKTCTAKKPLCDKCVINYCCEYFSRMGKH
NT seq 675 nt   +upstreamnt  +downstreamnt
gtgtgtaacccaaaagaacttttaaataaattatctaatgtttattctatagacccaaag
gattttgtagcatactatgtgtgtaaaaacacaagtgatgtgtttaaaacatttgttgct
acaattctctcacagaattctactgataaagcaacatatgttgcatataataatcttgaa
aataaaattggagttacggttgataagattttaagcataagtgaagatgaacttaaggaa
gttattaagattgtaggtctttccaattcaaaagcaaggtatataaagaatatagcatta
tttttcaaaagaaataaaatagatgagcttacaagacttccttgcgacaaattaagggaa
ttatttcttactgtagacggaattggtgaaaaaaccgctgatgttgttctggtaaattgt
tttaaatgtaagtttttcccagtggatacacatataaaaagagttatgagccgtctaggt
attttagggtcaaaaccacaatataaagaaattgctgatttctttatatcgtcacttaat
gaagatgaattgctagaattacatcagttgctaatacttcacggaagaaaaacttgcact
gcaaaaaaacctttatgcgataaatgtgtaataaattattgctgtgaatatttctctcga
atgggtaagcactaa

DBGET integrated database retrieval system