KEGG   Sulfurisphaera tokodaii: STK_14620
Entry
STK_14620         CDS       T00062                                 
Symbol
hisF
Name
(GenBank) imidazole glycerol phosphate synthase subunit HisF
  KO
K02500  imidazole glycerol-phosphate synthase subunit HisF [EC:4.3.2.10]
Organism
sto  Sulfurisphaera tokodaii
Pathway
sto00340  Histidine metabolism
sto01100  Metabolic pathways
sto01110  Biosynthesis of secondary metabolites
sto01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:sto00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00340 Histidine metabolism
    STK_14620 (hisF)
Enzymes [BR:sto01000]
 4. Lyases
  4.3  Carbon-nitrogen lyases
   4.3.2  Amidine-lyases
    4.3.2.10  imidazole glycerol-phosphate synthase
     STK_14620 (hisF)
SSDB
Motif
Pfam: His_biosynth NMO TMP-TENI Dus G3P_antiterm ThiG PcrB DeoC DHO_dh Trp_syntA FMN_dh IMPDH DUF2625
Other DBs
NCBI-ProteinID: BAK54589
UniProt: Q970Z0
Position
1466272..1467021
AA seq 249 aa
MTAKRIIACLDVKNGRVVKGVNFLNLKDKGDPVELASRYEEEGADEIVFLDITATIEGRK
ALLEVVKNTASVLSIPLTVGGGIRTIEDVSRILGNGADKVSINTAAVENKKIITEASEQF
GAQAIVVAIDVKRVNNSFIVFTRSGTYNTGIDAIQWAKEVEKLGAGEILLTSIDKDGTRE
GYDIELTKEVNNSVNIPVIASGGAGKMEHFYEVLKVADAALAAGVFHDGVIKIPELKRFL
LEKGIEVRV
NT seq 750 nt   +upstreamnt  +downstreamnt
atgacagctaaaagaataattgcttgtttagatgtaaaaaacggtagagtagtcaagggt
gtaaatttccttaacttaaaagacaagggagaccccgtagaattagcatctagatacgaa
gaagaaggagcggacgaaatagtatttttggatattacagctactatagaaggaagaaaa
gcattattagaagtagtaaaaaatacggctagcgtattatctataccactgacggtagga
ggtggaataagaacaatagaagatgtttcaagaattctaggtaatggcgctgataaagta
agtataaatacagcagcagttgaaaacaaaaagataataactgaggcctctgaacaattt
ggtgctcaagcaattgttgtagcaattgatgtgaaaagggttaataattcgttcatagtt
tttactagatctggtacctataataccggtatagacgcaattcaatgggcaaaagaagta
gaaaaattgggtgctggggaaattttgcttacaagtattgataaagatggtacaagagaa
ggatatgatatcgagcttacaaaagaggtaaataattctgtaaatattccagttattgct
agtggtggtgcagggaaaatggaacatttttatgaggttttaaaagttgcggatgccgcg
ttggctgcaggtgtttttcatgatggcgttattaagatccctgaacttaaaaggtttttg
ttagagaagggtatagaggtgagagtatga

DBGET integrated database retrieval system