KEGG   Sulfurisphaera tokodaii: STK_14770
Entry
STK_14770         CDS       T00062                                 
Symbol
pyrD
Name
(GenBank) dihydroorotate dehydrogenase
  KO
K00226  dihydroorotate dehydrogenase (fumarate) [EC:1.3.98.1]
Organism
sto  Sulfurisphaera tokodaii
Pathway
sto00240  Pyrimidine metabolism
sto01100  Metabolic pathways
sto01240  Biosynthesis of cofactors
Module
sto_M00051  De novo pyrimidine biosynthesis, glutamine (+ PRPP) => UMP
Brite
KEGG Orthology (KO) [BR:sto00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00240 Pyrimidine metabolism
    STK_14770 (pyrD)
Enzymes [BR:sto01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.98  With other, known, physiological acceptors
    1.3.98.1  dihydroorotate dehydrogenase (fumarate)
     STK_14770 (pyrD)
SSDB
Motif
Pfam: DHO_dh
Other DBs
NCBI-ProteinID: BAK54595
UniProt: F9VNE9
Position
complement(1475654..1476520)
AA seq 288 aa
MINLAGIQFKDPIIISSGIVTLSKIKEVCKNYLPSAITTKTLTLKPLNPHDPPTLVKFHD
KCYLNAIGLGNPGIDELKKINEMECKLIVSVGGSSIDEIIEVIKKVDRGEIIELNLSSPN
RKGYGESLASYVYEVVKNVKGVTNKPVFVKLGPWDNIIEIAGRAISAGADGLSLINTVKG
MVIDVETFKKVMHYGTGGISGKCIHPLAVRIIHDVYKEYNVDIIGMGGVFSGIDAIELMS
VGAKLIGLGTVIIDEGYSSIIRIRKEMEEYLKEKGLKYSDIIGVAVKK
NT seq 867 nt   +upstreamnt  +downstreamnt
ttgataaatctagcaggtatccagtttaaagatcctattatcatatcttctggcatagta
acattatctaaaataaaagaagtgtgcaaaaactacttgccatctgctataacaactaaa
acattgactcttaagccacttaacccccatgatccacctacattagtgaaatttcatgat
aagtgttatcttaatgctatcggtcttggaaacccaggaatagacgaactaaagaaaata
aatgaaatggaatgcaagttaattgttagtgttggtggaagtagtattgatgagataata
gaagttataaagaaagttgatagaggggagattattgaattaaacctgagtagccctaat
aggaaggggtatggagaaagtctagcttcttacgtttatgaggtcgtaaagaatgtgaaa
ggagtaactaataaacccgtatttgttaagttagggccttgggataatataatagagatt
gctggtcgagctatatctgctggagctgacgggctttcacttattaacacagtaaaagga
atggtcatagatgtagagacatttaagaaagtcatgcattatggtactggaggaatatct
gggaaatgcattcatcctctagccgtaagaattatccatgacgtgtataaagagtataac
gttgatattataggtatgggtggtgtcttttccgggatagacgctattgagctaatgtct
gttggtgcaaagttaatagggcttggtactgtaatcattgatgaaggatattctagtatt
ataaggataagaaaagaaatggaagaatatttaaaagaaaaaggattaaaatattcagat
ataataggtgtagcagtgaaaaaatga

DBGET integrated database retrieval system