KEGG   Sulfurisphaera tokodaii: STK_15050
Entry
STK_15050         CDS       T00062                                 
Symbol
argE
Name
(GenBank) putative acetylornithine deacetylase
  KO
K19412  glutamate---[amino group carrier protein] ligase [EC:6.3.2.60]
Organism
sto  Sulfurisphaera tokodaii
Pathway
sto00220  Arginine biosynthesis
sto01100  Metabolic pathways
sto01210  2-Oxocarboxylic acid metabolism
sto01230  Biosynthesis of amino acids
Module
sto_M00763  Ornithine biosynthesis, mediated by LysW, glutamate => ornithine
Brite
KEGG Orthology (KO) [BR:sto00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00220 Arginine biosynthesis
    STK_15050 (argE)
Enzymes [BR:sto01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.60  glutamate---[amino group carrier protein] ligase
     STK_15050 (argE)
SSDB
Motif
Pfam: RimK ATP-grasp_3 GSH-S_ATP ATPgrasp_ST PS_pyruv_trans
Other DBs
NCBI-ProteinID: BAB66577
UniProt: Q970U6
Structure
Position
1504037..1504885
AA seq 282 aa
MRVVLIVDIVRQEEKLIAKALEENKVQYDIINVAQEPLPFNKALGRYDVAIIRPVSMYRA
LYSSAVLEAAGVHTINSSDVINVCGDKILTYSKLYREGIPIPDSIIALSAEAALKAYEQR
GFPLIDKPPIGSWGRLVSLIRDVFEGKTIIEHRELMGNSALKAHIVQEYIQYKGRDIRCI
AIGEELLGCYARNIPPNEWRANVALGGTPSNIEVDEKLKETVVKAVSIVHGEFVSIDILE
HPNKGYVVNELNDVPEFKGFMVATNINVAQKLVEYIKENYSK
NT seq 849 nt   +upstreamnt  +downstreamnt
atgagagtggtcttgatagttgatattgtaagacaagaagagaaattaatagcgaaagca
ctagaggaaaataaggttcaatatgatataataaatgttgcacaagaacctctaccattt
aataaagcacttggtagatacgatgtagcgataataagaccagttagcatgtatagagca
ttatattcttcagctgtgcttgaagctgctggagttcataccataaactcaagtgatgta
ataaatgtgtgtggagataagattttaacgtactctaaattgtatagggagggaattcca
attccagattcaataattgctctttctgcagaagcagcattaaaagcttatgagcaaagg
ggatttccattaatagataaaccaccaataggaagctggggtaggttagtctcattaatt
agggatgtatttgaaggtaaaacaataattgaacacagagagctaatgggtaattctgct
ttaaaagctcatatagttcaagaatacattcagtataaaggtagagatataagatgtata
gcaataggagaagagctattaggttgttatgctagaaatattccaccaaatgaatggagg
gctaatgtagctttaggtggaactccttcaaacattgaagttgatgagaaattaaaggaa
actgtagtaaaagctgtaagcattgttcacggagaatttgtttcgatagatatactagag
catccaaataaaggttatgtagttaacgaattaaatgatgtaccagagttcaagggtttc
atggtagcaactaatataaatgttgcacaaaagctagttgaatatataaaagaaaactac
tctaaatga

DBGET integrated database retrieval system