KEGG   Sulfurisphaera tokodaii: STK_15800
Entry
STK_15800         CDS       T00062                                 
Name
(GenBank) putative prolidase
Organism
sto  Sulfurisphaera tokodaii
SSDB
Motif
Pfam: Amidohydro_1 Amidohydro_3
Other DBs
NCBI-ProteinID: BAB66656
UniProt: Q970L7
Position
complement(1577048..1578232)
AA seq 394 aa
MISLIGKIFDGEKIIEKGTVVIDGDKIVKIVEEESKEGEVIYGNFIMPGLIDTHIHFFGV
DEDNLLSWNLVNEIDVAIRSTRDMERILRSGFTTVRDLGSKVAVNLARLQRKGEIIGPTV
IASGYSLSITGGNDDPKSLPIDIAQRLSYSFYCDSPYECRKAVRMAIRQGATVIKVYASG
AFSQGGKIMPGFSLDELKAIVEEAHRNGLKVASHAYGKEAIMNSVLAGVDTIEHGLGLDE
ESATLIKEKGVCYIPTLATYEIPFEVDPIVRPFREELVKRHFTEDMRIAISKGLKIALGT
DYVGSKQRPHGKNYREAVLLSRYMPNVEVLKSATSIASECLGLHNVGRIREGYNADVIVL
NADPLNDIENLSPQHIMYVIKEGQKYKGYALFND
NT seq 1185 nt   +upstreamnt  +downstreamnt
atgataagtttaattggaaagatttttgatggagagaaaataattgaaaagggaactgtt
gttatagatggagataaaatagtcaaaatagtagaagaagagagtaaagaaggagaagtt
atatacggaaatttcataatgcctggtttaattgatacccatatacatttcttcggtgta
gatgaggataatcttctgtcatggaatctcgttaacgaaattgacgtcgctataagaagt
acgagagatatggaaaggattttaagatcggggtttacaaccgttagggatttagggagt
aaagtagcggttaatttagccagattacaaagaaaaggtgagatcataggacctactgtc
attgcttctggatactcgttatcaataactggaggtaatgatgaccccaaatcattacct
attgacatagctcaaaggctttcatattccttctattgtgattccccatatgagtgcaga
aaggccgtaagaatggcgataaggcagggtgcaacagtaataaaagtttatgcttctggt
gcattttctcaaggaggaaaaataatgccgggattttcactagatgagttaaaagcaatt
gttgaagaggctcatagaaatggacttaaagttgcgtctcatgcctatgggaaggaagct
attatgaactcagtcctagctggagttgatacgatagaacatggtttaggcttagatgag
gaatctgccactttaattaaagaaaaaggagtatgttatatacctacattagcgacttac
gaaataccatttgaagtagatccaatagttagaccatttagagaagaactagttaaaagg
cacttcactgaagatatgagaattgcaatatctaaaggtttgaaaattgcattgggaact
gattatgtaggatctaaacaaagacctcacggaaaaaattatagagaagctgtactactt
tcaagatatatgccaaatgtagaagtattaaaatctgcaacttctatagctagtgaatgc
ctaggattacacaatgttggcagaataagagaaggttataacgctgatgtaatcgtatta
aacgctgatcccttaaatgacatagaaaacttatcaccacaacatataatgtatgtgata
aaagaagggcaaaagtataaaggttatgctctttttaatgattaa

DBGET integrated database retrieval system