KEGG   Sulfurisphaera tokodaii: STK_16130
Entry
STK_16130         CDS       T00062                                 
Symbol
xpb2
Name
(GenBank) DNA-dependent ATPase XPBII
Organism
sto  Sulfurisphaera tokodaii
SSDB
Motif
Pfam: ResIII Helicase_C ERCC3_RAD25_C DEAD XPB_DRD SNF2-rel_dom Helicase_C_2 AAA_19
Other DBs
NCBI-ProteinID: BAB66691
UniProt: Q970I2
Structure
Position
complement(1609732..1611051)
AA seq 439 aa
MVYLRYFKGLILSDAYAPGLKWSDELKAYSALAFKYRDVRKYFLEKEIEVEENVIDSLPF
PLIKDKIELRDYQAEAVKAWLKEKRGIIVLPTGAGKTQVALKIVSIMKVATLIVVPTIDL
ITQWKERINKYLDFDPGIIGGGEDSLKGITVITYDSAYTRAEELGNKFPLLIFDEVHHLP
SEGYSIMAQLFASPYRLGLTATPERDDGKHELYPILVGPIVYRKSVEELAGKYIAKYKIK
KLYVSLTNEEKKRYDGLRKKLKDFLSSRGLKLQNLDDFHRLVKLAAKDKEAREALLAWHE
SLNIAVNSQSKIEKLREILQEYKNEKIIVFTRDTQMAYRISKTFLIPVVTYKTDKDEREE
ILQKFRDGEYRVIVASTVFDEGVDVPDATLAIVMGGYGTKRQFLQRLGRILRKKDKEALL
IEIVTKGTADYRLSRRRRE
NT seq 1320 nt   +upstreamnt  +downstreamnt
gtggtatacttaagatactttaaagggttaatactctcagatgcttatgctccaggttta
aaatggagtgatgagctaaaggcttattctgcattagccttcaagtatagggatgtcaga
aaatatttccttgagaaagaaatagaagtcgaggagaatgtaatagactccttacctttc
ccactaattaaagataaaattgagctaagagattaccaagctgaggctgtaaaagcctgg
ttaaaggaaaaaagaggaattatagttcttcctactggagctggtaaaacgcaagtggca
ttaaagatagtctcaatcatgaaggtagctactctaatagtggttcctacaatagatcta
ataactcaatggaaagagagaataaataaatacctagactttgatcccggaattattgga
ggaggggaagactcgctaaaaggtataacagttataacttatgattccgcatatacaaga
gctgaagagttagggaataagtttcccttgttaatattcgacgaagtgcatcatttaccc
tcagaaggatactcaataatggctcaactttttgcttctccatatagattaggattaaca
gcaacaccagagagagatgacggaaaacatgagctttatcctatacttgtaggaccaata
gtttataggaagagcgtagaagaactagctggaaaatatattgctaaatataaaattaaa
aagttatatgtttctttaactaacgaggaaaagaaaagatatgatggactacgaaagaag
ttgaaggattttctaagttctaggggattaaagttacaaaacttagatgatttccataga
ttagttaaactagctgcaaaagataaggaagctagggaagctttactagcatggcatgaa
tcacttaatattgcagtaaactcacaatctaagatagagaagttaagagaaattttacag
gaatataaaaatgagaaaataatagtatttactagagatactcagatggcatatagaatt
tcaaagacttttctaataccagttgtaacgtataagactgataaagacgagagagaggaa
attttacaaaaatttagagatggtgaatatagagttattgtcgcatctacagtttttgat
gaaggagtagacgtgccagatgcaacgttagctattgtaatgggtggttacggtactaaa
agacaatttcttcaaaggttgggaagaatattaaggaaaaaagacaaggaggctttatta
atagaaatagtcactaagggaactgctgattataggctaagtaggagaaggagagaatga

DBGET integrated database retrieval system