KEGG   Sulfurisphaera tokodaii: STK_16220
Entry
STK_16220         CDS       T00062                                 
Symbol
hypE
Name
(GenBank) putative hydrogenase expression/formation protein HypE
  KO
K04655  hydrogenase expression/formation protein HypE
Organism
sto  Sulfurisphaera tokodaii
Brite
KEGG Orthology (KO) [BR:sto00001]
 09190 Not Included in Pathway or Brite
  09192 Unclassified: genetic information processing
   99975 Protein processing
    STK_16220 (hypE)
SSDB
Motif
Pfam: AIRS_C AIRS
Other DBs
NCBI-ProteinID: BAK54625
UniProt: F9VNH9
Position
1618858..1619880
AA seq 340 aa
MRLGKIDEKIFSEIIYPNLGKRHKEVIVEPQSGVDTGAIDLGDGRVLVVKSDPVFIVPQF
GFKKAAWFAVHILASDVMTSGIPPKYALIDLNLPPKIRDEEFKEMWLGIHEALNEINVMV
VGGHTGVYEGTDYPMVGGFSMIGIGEKEKLGTPSKVRIGDSIIITKGPAIEATGLLVNLY
PEYFRERLPQDIFKEAYDMYWKMSCWKDGLIASNVGIHLMHDATEGGVWNALVEIATVTK
KELRIYEDKLFINRAVKEVTSLVNIDPWSSISEGTMIIISDKGEKIVEALKREGIESAIV
GEVKEGDGVTLVKKDGSKQRIEKPAEDPFWRVFFELSKKA
NT seq 1023 nt   +upstreamnt  +downstreamnt
atgagactgggaaagattgacgagaaaatcttttctgaaataatttatcccaatctaggg
aaaagacataaggaagttattgttgaacctcaaagtggtgtagatactggtgctattgat
ttaggtgatggcagagttttagttgtaaaatcagacccagtatttatagttccccaattt
gggtttaagaaagctgcctggtttgctgttcatattttagcaagcgatgttatgacttct
ggaattcctcctaaatacgcattaattgacttaaacttacctcctaagatcagagatgaa
gaattcaaggaaatgtggttaggaattcatgaagccttaaacgagataaatgtaatggta
gtaggtgggcatactggtgtatatgaagggacagattatcccatggttggagggtttagt
atgattggtattggcgaaaaagaaaagctaggtaccccatcaaaggttagaataggtgat
tcaattataattactaaaggaccggcaattgaagctactggacttttagttaatctttat
cccgagtacttcagggagagacttcctcaagatatatttaaagaagcttatgacatgtat
tggaagatgagctgttggaaagatggtttaattgcctcaaatgttggaattcatttgatg
catgatgcaactgagggtggagtatggaatgcattagtagaaatcgctacggttacgaag
aaagaattaagaatttatgaggataagcttttcataaacagagctgttaaagaagtaaca
tcgttagttaatatagatccttggtcttcaataagtgaaggcacaatgattataataagt
gataagggcgagaaaattgttgaagcattgaagagagaaggaatagaaagtgctattgtt
ggtgaagttaaagaaggtgatggagttacattagttaagaaagatggtagtaagcagaga
atagaaaagcctgcagaggatccgttttggagagtattctttgaattgtcaaaaaaggct
taa

DBGET integrated database retrieval system