KEGG   Sulfurisphaera tokodaii: STK_17110
Entry
STK_17110         CDS       T00062                                 
Name
(GenBank) ATPase
Organism
sto  Sulfurisphaera tokodaii
SSDB
Motif
Pfam: AAA AAA_22 RuvB_N AAA_5 AAA_18 AAA_16 DUF815 AAA_14 AAA_lid_3 Vps4_C nSTAND3 TIP49 RNA_helicase AAA_28 AAA_7 AAA_24 bpMoxR AAA_33 Cytidylate_kin AAA_2 IstB_IS21 Parvo_NS1 Mg_chelatase AAA_17 SKI TsaE Sigma54_activ_2 TniB AAA_19 DUF5906 AAA_11 AAA_3 Zeta_toxin KTI12 NB-ARC ABC_tran AAA_30 Rad17 AAA_25 AAA_6 PhoH 6PF2K IPT HNH_repeat
Other DBs
NCBI-ProteinID: BAB66793
UniProt: Q96ZY0
Position
1711918..1713681
AA seq 587 aa
MNANTSTSPTSSLLSTYINAIELGIIILTFVIPLIYFIYFMRMMRVGHSQQRQLERKMNR
IPSITWDQIYDMEEIKARLDEIASYVMKKGKAYGVILFGPPGTGKTSIAKALANKLRWNY
FELKSTDVMSKWYGESEYLLDNFFNVVELNAPAVVVIDEIDGFTLKREGDIHEVTHRLIN
IFLMRLQELHDKSLPVLIIGTTNIPQEIDEALLRPGRFDEVIYVPLPDENGREKIWCGYV
QNVDCKELAKRSNRLSPADIKEIVEEVKIQCEKEGRTPTTQDFIKALENYKPSVSIQIIV
KFENIAKKYSRHKLGERPYGVPDVRWDDLGDLEDVKRIIKDSIELPLKRKDLAEKLGIKP
VKGLLLYGPPGTGKTSIAKALANELNASFIILSGEEISSAGPFNAGEIIAEKFHIARDNA
PAIIFIDEIDMIARARGENEWRTALTELLNQMDGIRENEEIVVVGATNRPWDLDPAILRP
GRFDKIIYVPPPDEKGRAEVLKVLCRGLTVDEETLQKVAKITDGYTPADLKLVVDEIRRN
LLKEATITGVARTTLTFNDFIKILANVKPSVNKETLKMYEEFKIQRI
NT seq 1764 nt   +upstreamnt  +downstreamnt
atgaatgctaacacatcaacatctcctacttcttcactactttcaacatatattaatgcg
attgaactgggaattataattttaactttcgtcattccgttaatctactttatttacttt
atgagaatgatgagagtagggcattcacaacaaaggcaattagaaaggaaaatgaataga
ataccatcaatcacatgggatcagatttacgatatggaagaaattaaggctagattagat
gaaattgctagttacgttatgaaaaaagggaaagcttatggtgtaatactatttggtcct
ccaggtactggaaagacaagcattgctaaggcactcgctaataaacttagatggaattac
ttcgaattaaagtctaccgatgtaatgagcaaatggtatggtgaaagtgagtatttactt
gataacttctttaatgtagtggaattaaacgctccagccgttgtcgtaattgatgaaatt
gacggatttactctaaaaagagagggagatatccatgaagtcactcacagattaattaac
atatttttaatgaggttacaagaattacatgacaagagcttaccggtacttattattgga
acaacaaacatcccgcaagaaatagatgaagcacttttaagaccaggaagatttgatgag
gtgatttacgtacctttgccagatgaaaatggcagagaaaaaatatggtgcggttacgtt
caaaacgtcgattgcaaagaattagctaaaagaagtaatagactttcaccagcagacata
aaagaaattgtcgaagaagtgaaaatccagtgcgaaaaagaaggaagaactccaacaaca
caagactttataaaggccttagaaaactataaaccgtctgtatctatacaaattatcgta
aaatttgaaaatattgctaaaaaatactcaaggcataaactaggtgaaagaccatatgga
gtaccggatgtaagatgggatgacttaggagatctagaggatgttaaaagaataatcaag
gactctatagagttaccgctgaagaggaaagaccttgccgaaaagctgggaataaaacca
gttaaaggattattactttacggtcctcctggtactggaaagacaagcattgccaaggca
ttagcaaatgagcttaatgcttcctttattatcctatctggtgaggaaatatcttcagct
gggccatttaatgcgggagaaataattgcagaaaagttccatattgctagggataatgca
cctgcaataatattcattgacgaaattgatatgatcgctagggctaggggtgaaaacgaa
tggagaaccgcattaactgaacttttaaatcagatggatggtataagggaaaatgaagaa
atagtagtagttggggcaacaaatagaccatgggacttagacccggcaatactaagaccg
gggagatttgataagataatctatgtaccgccaccagatgaaaaaggaagagccgaagtt
cttaaagtattatgtagaggtttaactgtagatgaggaaactttacaaaaagtcgctaaa
atcactgatggttatacaccagccgatttaaaactggtagtggatgagattaggagaaac
ttacttaaagaggcaacgattactggagttgccagaactacattaacctttaatgatttc
ataaaaatattagctaatgttaaaccaagcgttaataaagaaacattgaaaatgtatgaa
gagtttaaaatacagaggatttaa

DBGET integrated database retrieval system