KEGG   Sulfurisphaera tokodaii: STK_20840
Entry
STK_20840         CDS       T00062                                 

Definition
(GenBank) putative Xre family DNA-binding protein
Organism
sto  Sulfurisphaera tokodaii
SSDB
Motif
Pfam: HTH_3 HTH_19 HTH_26 HTH_31 HTH_25 HTH_37 HTH_psq HTH_24 HTH_35 HTH_7 HTH_10 LysM MarR Bin3 HTH_23
Other DBs
NCBI-ProteinID: BAB67183
UniProt: Q96YU3
Position
2089442..2090989
AA seq 515 aa
MEYPIGKRITEIREKKGISVTQLAKMAGISKSTLWEIENGKISPNISTLWSIANALGVTF
GELITYDIVVKDEGSEVRLIERNNNIEVYLMKLNGGSVRYSKAHSNSPVELVHVIKGAMI
VGPFESPEFVWEGKTVKFYGGVDHVYAAVGGEAEAIVTMKYFSEKSITKIEYRNIKEIKI
EKYRDLLESKAVNNNVLATAISTINDHDASHLQNDDLLLFDVLSAELKTLSGTLTVPKVV
FNSLNSLGLAERSSVTNFEKNIDVVRYYIYEPLHPGYAEQAVFVAYELERRNIKDVISIG
CGPAYHEAMLKEIIPDLSITCIENSQFFKKLSPFKVLDEVPNGVNAIISFGSSHHIEGFL
RLVANKLKKGGTLIVSDEFVADYSSERERKRNVIRHHLGYLLDIPLAEFREELLSAFNAK
NIDISLGILSRIYIKIFKNIKDKITIDRVEDAFLNFYYLELTSLLLGVAYIEEKKVSLNK
FIAESSMLGLKLDSVYKVYPTGKDSGTYVVAFTRA
NT seq 1548 nt   +upstreamnt  +downstreamnt
gtggagtatcctataggcaagagaataacggagatcagggaaaagaagggaattagcgta
acgcaactggcaaaaatggcaggaatatcaaagtccacgctttgggaaatagagaacggt
aaaatatctcccaatatttcgaccctttggagcatagccaacgcattaggtgttaccttt
ggcgagctcataacttacgatatcgtcgtcaaggatgaggggtctgaggttcgattaatc
gaacgaaacaacaatatagaagtatacttgatgaagctaaacggcggttcggttagatat
tctaaagcacatagcaattctccagttgagttagttcacgtaattaagggagctatgata
gttgggccgttcgaaagtccagagtttgtgtgggaaggcaaaacggttaagttctatgga
ggcgtggaccacgtttatgcggcagtagggggagaggcggaagcaatagtaacaatgaag
tacttctccgaaaagagtatcactaaaattgaatatagaaatattaaggaaataaaaata
gaaaaatatagggatttgttggaaagcaaagcggtaaataacaacgtattagcaactgcg
atttcaaccataaatgatcacgacgcaagccacttgcagaatgacgatctcttgctgttc
gacgtattatcggctgagctcaagaccttgtctgggactttaacggtacctaaagttgta
tttaactctttaaactctttaggattagccgaaagatcttctgttactaatttcgaaaaa
aacatagatgtagtaagatattatatctatgagccgctgcatccaggctatgcggagcaa
gcagttttcgtcgcgtacgagctagaaaggaggaacataaaagacgtgatcagcataggc
tgtggccccgcatatcatgaggctatgcttaaagaaattataccagatttaagcataact
tgcatagaaaattctcagttctttaagaaactttcgccgtttaaagtattagatgaagtg
ccaaacggcgtaaacgcaattatatctttcggctcttctcatcatattgagggcttccta
aggctggtcgctaataaactaaagaagggcgggacgctaatagtctcggacgagttcgta
gctgactattcttcagaaagggagagaaagaggaatgtaattaggcaccacttgggttac
ctgctcgacatcccgttagccgagttcagggaagaactactgtcagcttttaacgccaaa
aatattgatatttcgctcggcatactatcaagaatttatattaaaatattcaaaaacatt
aaggataaaataacaattgatagagtagaagatgcattcttaaacttctactatttggag
ttaacgtcgctccttttgggcgtagcatacatagaagagaaaaaagtatctttaaataaa
tttattgcagaatcatctatgcttggcctgaagctcgactcagtttacaaggtttacccc
actggaaaggacagcgggacttacgtcgtcgcattcaccagggcatga

DBGET integrated database retrieval system