KEGG   Sulfurisphaera tokodaii: STK_24790
Entry
STK_24790         CDS       T00062                                 
Symbol
kdgA
Name
(GenBank) 2-keto-3-deoxy-gluconate aldolase
  KO
K11395  2-dehydro-3-deoxy-phosphogluconate/2-dehydro-3-deoxy-6-phosphogalactonate aldolase [EC:4.1.2.55]
Organism
sto  Sulfurisphaera tokodaii
Pathway
sto00030  Pentose phosphate pathway
sto00052  Galactose metabolism
sto01100  Metabolic pathways
sto01120  Microbial metabolism in diverse environments
sto01200  Carbon metabolism
Module
sto_M00309  Non-phosphorylative Entner-Doudoroff pathway, gluconate/galactonate => glycerate
sto_M00633  Semi-phosphorylative Entner-Doudoroff pathway, gluconate/galactonate => glycerate-3P
Brite
KEGG Orthology (KO) [BR:sto00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00030 Pentose phosphate pathway
    STK_24790 (kdgA)
   00052 Galactose metabolism
    STK_24790 (kdgA)
Enzymes [BR:sto01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.2  Aldehyde-lyases
    4.1.2.55  2-dehydro-3-deoxy-phosphogluconate/2-dehydro-3-deoxy-6-phosphogalactonate aldolase
     STK_24790 (kdgA)
SSDB
Motif
Pfam: DHDPS
Other DBs
NCBI-ProteinID: BAK54808
UniProt: F9VPG1
Position
complement(2481781..2482653)
AA seq 290 aa
MDIVTPILTPFTKEGKIDVEKLKAHAKFLIDNGIDLLFVNGTTGLGPALSKEEKLTTLKT
IYDVTNKVIFQVGSLNINDVIDLVKASKDFDIVGIASYPPFYFPRLPEKFLLKYFTTIAN
YSPHSLYIYNYPLATGYDISAKIVYQMKDLITGLKDTNQDLSHSLEYKILMPNLKVYNGS
DSLVFYSLTSLDGSVTAASNYLPHVMKKMKEHITSGQVSKAIELQKLINKALDISRKYGQ
LSAIYYLVKEFLGYDVGYPRGPIFPLEEDEVKALLSEIQPVKKEIERAVS
NT seq 873 nt   +upstreamnt  +downstreamnt
atggatattgtaacacctattcttactccattcactaaggaagggaaaatagacgtagag
aaactaaaagcacacgcaaaattcttaatagataatggaattgacttacttttcgttaac
ggaactactggattaggaccggcactttcgaaagaagagaagcttacaaccttaaagaca
atctatgatgttacaaataaggtaatatttcaagttggtagcctaaatataaatgatgta
attgatctagttaaggcttcaaaagattttgatatcgttggaatagcctcttatccacct
ttctactttccaagattaccagaaaagttcttactaaaatactttactacaatagctaac
tattcccctcactcgctatacatttacaattatcctttagcgactggttatgatatttct
gcaaagatagtatatcaaatgaaggacttaattacaggtttaaaggatactaatcaagat
ctttcccactcattggagtataagattctaatgcctaacttaaaagtatataatggttct
gattctttagtcttttattcactgacttcattagatggaagtgtaactgcagcctcaaac
tacttacctcatgtaatgaaaaagatgaaagagcatatcacttctggacaagtaagtaaa
gcaatagaattacagaaattaataaacaaggcccttgatataagtagaaagtatggacag
ctatcagccatttactatctagtgaaggagtttttaggctatgatgttggctatcctaga
ggacctatatttcctttagaagaggatgaagttaaagccttgttaagtgagattcaaccc
gtaaagaaagaaatagaaagagctgtttcgtaa

DBGET integrated database retrieval system