KEGG   Sulfurisphaera tokodaii: STK_25360
Entry
STK_25360         CDS       T00062                                 
Symbol
cbtD
Name
(GenBank) cellobiose ABC transporter ATP-binding protein
  KO
K02031  peptide/nickel transport system ATP-binding protein
Organism
sto  Sulfurisphaera tokodaii
Pathway
sto02024  Quorum sensing
Brite
KEGG Orthology (KO) [BR:sto00001]
 09140 Cellular Processes
  09145 Cellular community - prokaryotes
   02024 Quorum sensing
    STK_25360 (cbtD)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:sto02000]
    STK_25360 (cbtD)
Transporters [BR:sto02000]
 ABC transporters, prokaryotic type
  Peptide and nickel transporters
   Peptides/nickel transporter
    STK_25360 (cbtD)
SSDB
Motif
Pfam: ABC_tran oligo_HPY AAA_21 SMC_N NB-ARC AAA_13 AAA_16 AAA_29 nSTAND3 AAA_22 MobB ATP-synt_ab NACHT DUF87 IstB_IS21 AAA_23 AAA GCD14 AAA_18 PRK NTPase_1 TsaE ATPase ResIII RNA_helicase RuvB_N RsgA_GTPase PIF1 AAA_14 ATPase_2 Mg_chelatase AAA_15
Other DBs
NCBI-ProteinID: BAB67648
UniProt: Q96XH9
Position
2544345..2545313
AA seq 322 aa
MTRLLLKVQDLSVAYFIHKQEIVALKDVSFEIERGEILGIIGESGSGKTTLAKAIIRSIK
PPGKITKGKILYEGEDILSVDIKRFKREYLWKKISYVPQASQNSLNGVMRIIDHFYDTAI
SHGITDRNTIYDKAKEAVKMVSLDERVLSSYPHELSGGMKQRVLIALSLLLDPELIILDE
PTSALDVATQKSILDLVMKINKELGTTIILITHDIGVANYIAKKMLVLYAGQVMEFGNTE
EIMNNPLHPYTQGLINSVPSIYKDVSKLKPISEGEIPLKGCPFHTRCSYVSEICKMEEPG
LYTANTRLVRCFLYDKARKNIS
NT seq 969 nt   +upstreamnt  +downstreamnt
gtgactagattgcttctaaaagtacaagatctatcagtagcttactttattcacaagcaa
gaaatagtagcattaaaagatgtttcttttgaaatagagaggggagaaatattaggaatt
attggagagagcggttctggaaaaacaactttggctaaagcgattattaggagcattaaa
cccccaggaaagataaccaagggtaaaatactttatgaaggtgaagatattctctcagtt
gacattaagagatttaaaagggagtatctatggaagaagatcagttatgtacctcaagct
agtcaaaattctttaaacggtgttatgagaataatcgatcatttttatgatacagcaata
tctcacggtattacagatagaaacactatatatgataaggctaaagaagctgtaaaaatg
gtatctttagatgaaagagttttatcatcttatcctcacgaactgagcggtggaatgaag
caaagagtattaattgccttatcacttcttcttgatcctgaacttattattttagatgaa
ccaacaagcgctttagatgtagctacgcaaaaatcaatccttgatttagtaatgaaaata
aataaggaactaggaactacaattattttaataactcatgatattggagtggctaattat
attgctaagaaaatgcttgtcttatatgctgggcaggttatggagtttggaaacactgaa
gaaataatgaataatccgctacatccttatacacaaggtttaattaattcagttccatca
atttataaggatgttagtaaattaaaacctataagtgaaggagaaataccgctaaagggt
tgtccttttcatactaggtgtagttatgtgtctgaaatttgcaagatggaggaaccgggg
ttgtatacagctaatactaggttagttaggtgttttctttatgataaagctagaaaaaat
atcagttaa

DBGET integrated database retrieval system