KEGG   Sulfurisphaera tokodaii: STK_25460Help
Entry
STK_25460         CDS       T00062                                 

Gene name
nagA
Definition
(GenBank) N-acetylglucosamine-6-phosphate deacetylase
  KO
K01443  N-acetylglucosamine-6-phosphate deacetylase [EC:3.5.1.25]
Organism
sto  Sulfurisphaera tokodaii
Pathway
sto00520  Amino sugar and nucleotide sugar metabolism
sto01100  Metabolic pathways
sto01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:sto00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    STK_25460 (nagA)
Enzymes [BR:sto01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.25  N-acetylglucosamine-6-phosphate deacetylase
     STK_25460 (nagA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Amidohydro_1 Amidohydro_3 DUF3236
Motif
Other DBs
NCBI-ProteinID: BAB67658
UniProt: Q96XG9
Position
2555627..2556742
Genome map
AA seq 371 aa AA seqDB search
MELKLTNAKIITPYKEIERGSVIIKDGIISEILEERTEGEDLEGMLLLPAFVDIHTHGIG
GYDYTSWDSEDDFIKNAIGMKKKLIQHGVTTFLPTTVTMPRESLLEACKAISQTDILGLH
LEGPYISEKHAGAQDVRYIRNPDKNEVLECVRESNNKVITITYSPEKDLDFIPFMLSLGI
YPSIGHTDADYETAVKAFLLGASRVTHLFNAMRAFHHRDPGVILASINFSPFIEIIPDFI
HVDKEVVRFLTKIVDIKRIVAVTDSIIATDLQDGTYTLGKMRIRVENGIARTEDGKLAGS
TLTMDKAFKNLSSIIGIREASLICSYNPARAIGLSDRGIIEKGKRADLIVMDEKLNVKKV
FINGEEIFSSS
NT seq 1116 nt NT seq  +upstreamnt  +downstreamnt
atggagttaaaattaacaaacgctaagatcataacaccttataaagaaattgaaaggggt
agtgtgataattaaagatggtataattagtgaaatattagaggaaaggactgagggggaa
gacttagagggaatgctcttacttccagcgtttgttgatattcatactcacggaattggt
ggatatgattatacatcatgggatagtgaggatgatttcataaaaaacgctatagggatg
aaaaagaaactgatccaacatggtgtaacaactttcttacctacaacagttacaatgcct
agagaaagtctgttggaggcttgtaaggctatatcacagacagatattttaggactccac
ttagaaggtccttatataagtgaaaaacatgctggtgcacaagatgtaagatatataaga
aacccagacaagaatgaagtgttggagtgtgtcagagagagtaataataaagtaataaca
ataacttattctcccgaaaaagatctggattttattccattcatgttaagtctgggaatt
tacccttcaataggacatacagatgcagattatgagacagcagttaaagcattcctctta
ggtgctagtagggttacacatttatttaatgcaatgagggcatttcatcatagagatcca
ggcgtaattttagctagtattaatttttctccatttattgaaataattccagactttata
cacgttgataaagaggtggtgaggtttttaactaaaatagttgatataaaaagaattgtt
gcagtaacagattctataatagctactgatcttcaagatggtacttatactttgggtaaa
atgaggataagggttgaaaatggtattgcaaggactgaggatggaaaattggccgggagt
actttaacaatggataaggcatttaaaaatctatcaagtattataggaataagggaggct
tcactcatatgttcatataatccagcaagggcaataggacttagtgacagagggattatt
gaaaaggggaagagggctgacttaatcgtaatggatgaaaagttgaatgttaaaaaagta
tttataaatggagaggagattttttctagcagttag

DBGET integrated database retrieval system