KEGG   Sebaldella termitidis: Sterm_2681
Entry
Sterm_2681        CDS       T01123                                 

Definition
(GenBank) aldehyde oxidase and xanthine dehydrogenase molybdopterin binding protein
  KO
K00087  xanthine dehydrogenase molybdenum-binding subunit [EC:1.17.1.4]
Organism
str  Sebaldella termitidis
Pathway
str00230  Purine metabolism
str01100  Metabolic pathways
str01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:str00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    Sterm_2681
Enzymes [BR:str01000]
 1. Oxidoreductases
  1.17  Acting on CH or CH2 groups
   1.17.1  With NAD+ or NADP+ as acceptor
    1.17.1.4  xanthine dehydrogenase
     Sterm_2681
SSDB
Motif
Pfam: Ald_Xan_dh_C2 Ald_Xan_dh_C Epimerase
Other DBs
NCBI-ProteinID: ACZ09526
UniProt: D1AMF2
Position
complement(2847441..2849732)
AA seq 763 aa
MSYKIIGQSVERWDAIAKVQGKADYTADLPKKNVLYGKILRATIAHGLVKKLDVSEALKV
EGVIKVLTPDDLPDLKFPTAGHPYTLDPKLADIADRNILTKRVRLYGDEIAAVIAENELA
AEKALEKIKVEYEEFPFYLSPEEALAEGAVEIHDGSKNLIASTKAVVGDLKKGLEEADHI
IEGEYKTQIVQHCHMENQIAYAYKGSDQRWVCVSSTQIPHICRRILGEAFGMPWGKFRVV
KPFIGGGFGNKQDVTIEPLAVAMSMAVGGEPVMVELQREESIAWTRVRHAISYKVKLGVK
KDGTITALEMDAVSNNGAYASHGHSIAGKGAGILQSLYKMPNMEYNSKTVYTNTASAGAM
RGYGVPQVIFAMESIIEKAAKELGIDPVELRLKNLVGPNTENPVSHVMFFSNKLKECVEE
GMKNFSWDERKKQADSQKTGDFRRGVGMAVFAYATGVYPKSLEIGGCRLTLNQDGTVKLM
VGATEIGQGSDTVFKQMVAETTGIPYDHIYTDMNTDTDYSPFDTGAYASRQSYVSGMAVR
KAAIELKEKILDAVKKFDDIDQLHTDIVNGNIVYKHSGEVIQSVGDLALKSYYDLANGEC
ITAEVSNNFHSNSNAMGATFADVEVDIKTGKVKILNILNVHDSGHILNPLLASGQVEGGM
GMAVAYALAEELRYDEKTGAPLNNNLLDYKMPTSMDLPDMETLFVEEDDPMGPYGNKALG
EPPICSPAAAIRNAVLDAIGIEVDELPIKPQKLMEILKNNGIV
NT seq 2292 nt   +upstreamnt  +downstreamnt
atgagctataaaattatagggcaaagtgtggaaagatgggatgcaatagcaaaagtacag
ggaaaagcagactatacagcagatttgcctaagaaaaatgtattatacggaaaaattttg
agagcaactatagcccatggattagtaaaaaaattagatgttagtgaagcactgaaagta
gagggagtaataaaggttctgactcctgatgatctgccggatttgaaatttcccacagca
ggtcacccgtatactctggatcccaagctggcagatattgcagacagaaatattcttacg
aaaagagtcagactgtatggtgatgagatagcggcagtgatagcagaaaatgaactggca
gcagaaaaagcactggaaaaaataaaagtagagtatgaagaatttccattttatctttcg
ccggaggaagcgcttgctgaaggtgcagtggaaattcatgatggttcaaaaaatttaata
gcttctacaaaggcagtggtgggagacttaaaaaaaggacttgaagaagctgatcatata
atagagggcgaatacaaaacacaaatagtacagcactgtcatatggaaaaccagattgct
tatgcttacaaaggttcggatcaaagatgggtttgtgtatcgtctacacaaatacctcat
atttgccgtcgtattttaggtgaagcatttggaatgccttggggaaaattcagggtagta
aaaccatttataggaggaggcttcggtaataaacaggatgttactatagaaccgcttgca
gtggctatgagtatggcagtcggcggagaacctgttatggtagagcttcagagagaagaa
agcattgcatggacaagagtaaggcatgctatatcgtataaagtaaagctgggagtaaaa
aaagacggtacgataactgctctggaaatggatgcggtatcaaataacggtgcatatgca
tcacacggtcattcaatagccggaaaaggagcaggaatattacagtcattatataaaatg
ccaaatatggagtataactcaaaaactgtgtatacgaatacagcttctgcaggagcaatg
cgtggatacggggttcctcaggttatatttgcaatggaatctataatagaaaaagcagct
aaggagctgggaattgatcctgtggaattaagactcaaaaacttggtaggaccgaatacg
gaaaatcctgtgagtcatgttatgttcttttctaataaattaaaagaatgtgtagaagaa
ggaatgaaaaattttagctgggacgaaagaaaaaaacaggctgacagtcaaaaaacaggt
gattttagaagaggagtgggtatggcagtatttgcctatgccacaggagtatatccaaaa
agccttgagataggcggatgccgccttacgctgaatcaggacggaacggtaaaattaatg
gtaggagctacagaaataggacagggatctgatacggtatttaagcaaatggtagctgaa
actacaggaataccatatgatcatatttatacagacatgaatacagatacagattactca
ccttttgatacaggagcctatgcttcaagacagagctatgtatcaggaatggcagtaaga
aaagctgctatagagcttaaagaaaaaatacttgatgctgttaagaaatttgacgatata
gatcagctgcatacagatatagtaaacggaaatatagtatataagcacagcggagaagta
atccaaagtgtcggtgatcttgctttgaaatcgtattatgacctggctaacggagaatgt
ataacagcagaggtttcaaataattttcacagcaactctaatgcaatgggagctactttt
gcagatgtagaggtagatataaaaactgggaaagtaaaaattctgaatatattaaatgtt
catgattccggccatatactaaatcctctgctggcaagcggtcaggtagaaggcggtatg
ggaatggctgttgcttatgctctggctgaagaactgagatatgatgaaaaaacaggtgca
ccgctgaataataacctgcttgattataagatgcctacttctatggatcttccggatatg
gaaacgttatttgtggaagaagacgatcctatggggccttatggaaataaagcccttgga
gaaccgcctatatgcagtcctgctgcagcgatcagaaatgctgttttggacgcaataggt
atagaggttgacgaactccctataaagcctcagaaattaatggaaatattaaaaaataac
ggaatagtttag

DBGET integrated database retrieval system