KEGG   Sulfitobacter sp. D7: B5M07_13755Help
Entry
B5M07_13755       CDS       T05714                                 

Definition
(GenBank) low specificity L-threonine aldolase
  KO
K01620  threonine aldolase [EC:4.1.2.48]
Organism
suld  Sulfitobacter sp. D7
Pathway
suld00260  Glycine, serine and threonine metabolism
suld01100  Metabolic pathways
suld01110  Biosynthesis of secondary metabolites
suld01120  Microbial metabolism in diverse environments
suld01130  Biosynthesis of antibiotics
suld01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:suld00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    B5M07_13755
Enzymes [BR:suld01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.2  Aldehyde-lyases
    4.1.2.48  low-specificity L-threonine aldolase
     B5M07_13755
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Beta_elim_lyase Aminotran_5 Pyridoxal_deC Amidohydro_1
Motif
Other DBs
NCBI-ProteinID: AYE87089
UniProt: A0A386TH19
Position
2835399..2836433
Genome map
AA seq 344 aa AA seqDB search
MFFASDNAGPVHPKVMERVIAANSDYAMPYGKDPIMDEVRAQIREQFEAPEAEVYLVATG
TAANALALACYTQPWQTIFCSKVAHIEEDECNAPEFYAGAAKLTLVETDDKMSPDALRRA
IVARAAGDVHTPQRGPVSITQVTERGGVHSLEELQALTAVAKEYDLPVHMDGARFANALV
ALGCTPAEMTWRSGVDVVSFGGTKNGCMGVEAVVFFDPKKAWEFELRRKRGAHLFSKHRF
LSAQMAGYLADGAWLETAKTANANAAHLAQGLRKAGAEFLHEPAANMIFARFPRAIHRKL
HDAGARYYLWDGTLDGDGNEMLAARMVCDWSISRDQIDQFLSHF
NT seq 1035 nt NT seq  +upstreamnt  +downstreamnt
atgtttttcgcctctgacaacgctggccccgtccaccccaaggtgatggagcgcgtgatc
gcggccaatagcgactacgccatgccctacggcaaagacccgatcatggatgaggtgcgc
gcgcagattcgcgaacagtttgaggcacctgaggcggaggtctacctcgtcgccaccggc
accgcggccaatgcgctggcgctggcctgctatacccagccgtggcagacgatcttttgc
tccaaggtcgcgcatatcgaagaggatgagtgcaacgcgccggagttctacgcaggtgcg
gccaagctgacactggtagagaccgacgacaagatgtcccccgacgccctgcgccgcgcc
atcgtcgcgcgggcggcgggcgatgtgcacacgccgcaacgcggcccggtgtcgatcacg
caggtgacggaacgcggcggggtgcatagccttgaagaattgcaggcgctgacagcggtg
gccaaggaatacgacctgcccgtgcatatggacggcgcgcggtttgccaatgcgctggtg
gctctgggctgcaccccggctgagatgacgtggagatcgggcgttgatgtggtcagcttc
ggcggcaccaagaacggctgcatgggggtcgaggcggtggtctttttcgaccccaaaaaa
gcatgggaattcgagctgcgccgcaagcgcggggcgcatctgttttccaaacaccgcttt
ctgtcggcgcagatggcgggctaccttgcggatggggcttggctggaaacggccaagacg
gccaacgcaaatgcggcgcatctggcccaagggctgcgcaaagcgggggcggaattccta
catgagcctgcggcaaacatgatctttgcccgcttcccccgcgccattcaccgcaagttg
catgacgcaggcgcgcgctattacctttgggatggcacgctggacggcgatggtaacgag
atgctggccgcgcggatggtctgcgactggtcgatcagccgtgaccagatcgaccagttc
ctaagccacttctaa

DBGET integrated database retrieval system