KEGG   Sulfurospirillum sp. JPD-1: SJPD1_1500Help
Entry
SJPD1_1500        CDS       T05109                                 

Definition
(GenBank) GTP cyclohydrolase II
  KO
K01497  GTP cyclohydrolase II [EC:3.5.4.25]
Organism
sulj  Sulfurospirillum sp. JPD-1
Pathway
sulj00740  Riboflavin metabolism
sulj00790  Folate biosynthesis
sulj01100  Metabolic pathways
sulj01110  Biosynthesis of secondary metabolites
sulj02024  Quorum sensing
Brite
KEGG Orthology (KO) [BR:sulj00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00740 Riboflavin metabolism
    SJPD1_1500
   00790 Folate biosynthesis
    SJPD1_1500
 09140 Cellular Processes
  09145 Cellular community - prokaryotes
   02024 Quorum sensing
    SJPD1_1500
Enzymes [BR:sulj01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.4  In cyclic amidines
    3.5.4.25  GTP cyclohydrolase II
     SJPD1_1500
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GTP_cyclohydro2
Motif
Other DBs
NCBI-ProteinID: ATB69609
UniProt: A0A290HW68
Position
1438259..1438822
Genome map
AA seq 187 aa AA seqDB search
MNIKISNIANLPSKFGNLKIQSFQEGIKEHLVIFKEPLGQIPLVRIHSECLTGDALGSLK
CDCGEQLEFALQNISSLGGMIIYLRQEGRNIGLFNKVNAYALQDQGFDTIEANHQLGFKS
DERSYEVVETILEHFKIDKIRLLTNNPKKMSCLKNIMIIERWPIIIPSNNHNVDYLKTKK
EMMGHLL
NT seq 564 nt NT seq  +upstreamnt  +downstreamnt
atgaacattaaaatctcaaatattgctaatcttccatccaaatttggaaatttaaaaatc
caatcttttcaagaaggtattaaagagcatttagtgattttcaaagaacctcttgggcag
attccattggttagaattcatagtgaatgtttaacaggggatgcacttggctctttaaaa
tgcgattgtggtgaacagcttgagtttgcattgcagaatatctcatcacttggtggaatg
atcatttacttacgtcaagaaggacgcaatattggtttgtttaataaagtaaatgcctat
gcgctacaagatcaagggttcgatactattgaagcaaatcatcagttgggttttaaaagt
gatgaacgtagttatgaagtggtagaaactattttagagcattttaaaattgataaaatt
cgtttgcttacgaataaccctaaaaaaatgagttgtttaaaaaacattatgattattgaa
agatggccaattattataccttcaaataatcataacgttgattatttgaaaactaaaaaa
gaaatgatgggtcatttactttaa

DBGET integrated database retrieval system