KEGG   Rhizorhabdus wittichii RW1: Swit_0164
Entry
Swit_0164         CDS       T00538                                 
Name
(GenBank) AAA ATPase
  KO
K20530  type IV secretion system protein TrbE [EC:7.4.2.8]
Organism
swi  Rhizorhabdus wittichii RW1
Pathway
swi02024  Quorum sensing
Brite
KEGG Orthology (KO) [BR:swi00001]
 09140 Cellular Processes
  09145 Cellular community - prokaryotes
   02024 Quorum sensing
    Swit_0164
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:swi02044]
    Swit_0164
Enzymes [BR:swi01000]
 7. Translocases
  7.4  Catalysing the translocation of amino acids and peptides
   7.4.2  Linked to the hydrolysis of a nucleoside triphosphate
    7.4.2.8  protein-secreting ATPase
     Swit_0164
Secretion system [BR:swi02044]
 Type IV secretion system
  Trb secretion system protein
   Swit_0164
SSDB
Motif
Pfam: P-loop_TraG CagE_TrbE_VirB TraG-D_C AAA_29 AAA_22 FtsK_SpoIIIE AAA_16 ABC_tran T2SSE ResIII DUF87 AAA_23
Other DBs
NCBI-ProteinID: ABQ66535
UniProt: A0A9J9H7T1
Position
155727..158195
AA seq 822 aa
MMFLREHARRASRLSDFLPWAAMIAPGIVLNKDGSFLRVARFRGPDLDSATQAELIATSN
RLNSALKRLGTGWAIYVEAQRKASPGYPVSTGFADPVSALIDEERRDQFEGGDVTQPNFT
SAYYLTLQWLPPADDTSRASSMLFEGGAEGIATAADHLEDFERDTGRVLDMIEGVMPEAA
WLSDGETLTFLHSTISTHEQNIAVPETPMHLDALLADDALVGGLTPQLGEKHLRVLSITG
FPAWTVPGMLDELNRLGFAYRWTTRAICMDKVTAQRTLSRIRRLWFSKRKSLAAIVKEVL
TNEASVLVDTDATNKSADADAALQELGADIAGFAYVTTTITVLGDTPRDADLKLQSIEKI
VRGRDFACIAESLNALEAWLGSLPGNPYANVRQPPISTLNLAHVMPVSAVWAGQDEDTHL
GAPPLFHARTEGATPFRFSLHVGDVGHTLVVGPTGSGKSVLLAFMALQFRRYEGAQIFAF
DHGGSIRAATLGVGGEWHDLGGALGGGGAPVALQPLARIDELDERAWAADWLAAILAQEV
FAITPEVKDHLWTALGSLADAPLEQRTLTGLAVLIQASGLKRALQPYTLAGPYGRLLDAD
GERFGTHDAQAFETEGLVGTPAAPAVLAYLFHRIGRRLDGRPTLILIDEGWLALDDPLFG
RQLKEWLKTLRKKNASVVFATQSLADIEGSAIAPAIIESCPTRLFLANERALEPQIAGIY
RRFGLNDRQIEIIASATPKRDYYCQSALGNRLFDLGLGPLALAFAAASQRSDLNAISALL
DAHGADGFADAWLRHRGLGWAADIVTAERPPSPALQEEEIIA
NT seq 2469 nt   +upstreamnt  +downstreamnt
atgatgttcctccgcgagcatgcccgccgcgcatcgcgcctctcggatttcctgccatgg
gcggcgatgatcgcgcccggcatcgtcctcaacaaggacgggagcttcctgcgcgtggcg
cggttccgtggccccgatctcgacagcgcgacccaggctgagctcatcgccacctccaat
cggctcaacagcgccttgaaacgcctcggcaccggctgggcgatctatgtcgaggcgcag
cgcaaggcctcgcccggctatccggtctcgaccgggttcgccgatccggtgtccgcgctg
atcgacgaggagcggcgcgaccagttcgagggcggcgacgtcacccagcccaatttcacc
agcgcctactatctcaccctgcaatggctccccccggccgacgacacgtcgcgcgcctcc
tcaatgctgttcgagggcggcgcggaagggatcgcgaccgccgccgatcatctggaggat
ttcgagcgggacacgggccgcgtcctcgacatgatcgagggcgtgatgccggaagccgcc
tggctctccgacggcgagacgctgacctttctgcattcgacgatctcgacgcacgagcag
aacatcgccgtgccggagacgccgatgcacctcgatgcgctgctcgccgacgacgcccta
gtcggcggcctgacgccacaactcggcgagaagcatctgcgggttctctccattaccggc
tttccggcctggacggtgccgggcatgctggacgagctcaatcggctaggcttcgcctat
cgctggaccacccgtgcgatctgcatggacaaggtgacggcacagcgcaccctgagcagg
atccgccgcctctggttctccaagcgcaagagcctcgccgcgatcgtcaaggaggtgctg
accaacgaggccagcgtcctcgtcgatacggacgcgaccaacaagtcggccgacgccgat
gccgccctgcaggaactcggcgccgacatcgccgggttcgcctatgtcaccaccaccatc
acggtgctgggcgacacgccgcgcgatgccgacctcaagctccagtcgatcgagaagatc
gtgcgcgggcgggatttcgcgtgcatcgccgagagcctcaacgcgctcgaagcctggctc
ggctcgctccccggcaacccttacgccaacgtccgccagccgccgatctcgaccctcaat
ctcgcccatgtgatgccggtctcggcggtctgggccgggcaggacgaagatacgcatctg
ggcgccccgccgctgttccatgcgcgcactgaaggcgcgaccccgttccgcttctcgctc
catgtcggcgatgttgggcacacgctggtcgtcggcccgaccggctcgggcaagagcgtg
ctgctcgccttcatggcgctccagttccgccgctacgagggcgcgcagatcttcgccttc
gaccatggcggctcgatccgcgccgcgactctcggcgtgggcggcgagtggcacgacctc
ggcggcgcgctcggcggcggcggcgcgccggtcgcactccagccgctcgcgcgcatcgac
gagctcgacgagcgcgcctgggccgccgactggctcgccgcgatcctggcccaggaagtg
ttcgcgatcaccccggaggtgaaggaccatctctggaccgcgctggggagcctcgccgac
gcgccgctcgagcagcgcaccctgaccggccttgccgtgctgatccaggcctcgggcctc
aaacgcgcgcttcaaccctatacgctggctggcccctatgggcggctgctcgacgccgac
ggcgagcggttcgggacgcatgacgcccaggcattcgagaccgaagggctggtcggcacg
ccggccgcgccggcggtgctcgcttatctgttccaccgaatcgggcgccggctcgacggg
cggccgacgctgatcctgatcgacgagggctggctcgcgctcgacgatcccctgttcggc
cgccagctcaaggaatggctgaagacgctgcgcaagaagaacgcgtcggtcgtcttcgcc
acccagagcctcgccgatatcgaaggctcggccatcgccccggcgattatcgagagctgc
ccgacccggctgttcctcgccaatgagcgcgcactcgagccgcagatcgccggcatctac
cggcggttcgggctcaacgatcgccagatcgagatcatcgcctcggcgacgcccaagcgc
gattattactgccagtcggcgctgggcaaccgattgttcgatctcggtctcggcccgctc
gcgctcgccttcgccgccgcctcgcagcgcagcgacctcaatgcgatttccgcgctgctc
gacgcccatggcgctgacggtttcgccgatgcctggcttcgccatcgcggcctcggctgg
gccgccgacatcgtcacggccgagcgccctccatcccccgccctccaagaagaggagatc
atcgcatga

DBGET integrated database retrieval system