KEGG   Rhizorhabdus wittichii RW1: Swit_5159
Entry
Swit_5159         CDS       T00538                                 
Name
(GenBank) Conjugative relaxase region-like protein
Organism
swi  Rhizorhabdus wittichii RW1
SSDB
Motif
Pfam: TrwC AAA_30 AAA_19 Viral_helicase1 AAA_11 AAA_16 NTPase_1 NACHT ABC_tran AAA_29 AAA TraI_2B
Other DBs
NCBI-ProteinID: ABQ71270
Position
pSWIT01:complement(50996..54040)
AA seq 1014 aa
MLSVAGVRSASGAANYFAKDDYYTVEGSSEISAWGGEGAEAIGLSGEVSKDAFEGVLNGI
LPSGEAVAQVENRRAGYDLTFSMPKSASVMAYVAGDKRVLDANMAAVKATMAWVEKNLAE
GRRDIEGRKVPVQTGNLVYALFQHDTSRALDPQAHIHAVIANLTRMPDGKWQALHADKLW
SHNSIIGSIYHAFLRAGLERIGYQVDLKGKHGTFEIAGVPKAVIGEFSQRREEILDHATR
LGIKSPEGLREITKRSRDPKLDVEDRAALKQGWIDQAAAHGFDGKDLRAAAEARAGMASS
ENALERGYRAIVDAVTGARQTLGALLRPQDPLVDNALARAVKSPAEARAQLAVASAVRIL
SEREAAWPVNLLGKTALDLGLKGVTVDLIERRIDRLVQNRQLIPGVATAADRTGRMVTTQ
EALRTEEKILAAVEEGKGKSEPIVAAADAPQRLQDAAERPLNPGQLAAATMILSSADRTV
SVQGAAGTGKSTMLQAVARVAEEEGARITGLAFQNKMVADLAEGAGIKAQTIASFVLANE
RFVTERDTLGYEAAREKLAGTMLLVDETSMVSSNEMLKLHQITAALGVDKLVLVGDRQQL
SSIDAGKAFAMIQAGGGTMARMDQNIRQRTDQLRTVAALANIGKAGAALKVLGDRVVEAG
EPAAAAADMWLELSPGEREATAVFASGRDARAVINQRIQDGLIAEGSVKGQAIHLTVFER
VNTTREELRYASTYRQGQTLEVGRGGAQDVGIKAGRYDVLKVHANGKVELSDGRRRIRFD
PQKLSPTEQRDRLQLSEKKDLQLREGDRIRWTANDKQRGLHNAALARVVGVDADGVKVET
ADKVLLTLSLGDPMLSRLDLAYSLNMHMAQGITTDKAITVMSSHERNLSNQRLFNVGVTR
VRDELTMVVDDKEKLARQLDMNPGNKTSSLETLGRLDIDGRKGPGAQPREKFDPGPIDGV
NLSDLAPVPSDLPPLPDGAASAPAAKAPQAPPDLKPDRGDPLPPLPERSLGLDL
NT seq 3045 nt   +upstreamnt  +downstreamnt
atgctctcggtcgccggcgtccgctccgcttccggtgccgcgaactatttcgcgaaggac
gactattacacggtcgagggctcgtccgagatcagcgcctggggaggggagggcgccgag
gcgatcggcctgtccggagaagtctcgaaggacgccttcgagggcgtgctgaacggtatc
ctcccaagcggcgaagcggtcgcccaggtcgagaaccggcgcgccggctacgacctcacc
ttctccatgccgaagtcggcttcggtcatggcctatgtcgccggcgacaagcgcgtgctt
gacgccaatatggccgcggtcaaggcgaccatggcctgggtcgagaagaacctcgcggaa
gggcgtcgcgacatcgaggggcgcaaggtcccggtccagacgggcaatctcgtctacgcg
ctcttccagcacgacacgagccgggcgctcgatccgcaggcccacatccacgccgtcatc
gccaacctcacccgcatgcccgatggcaaatggcaggcactccacgccgacaaactctgg
agccacaacagcatcatcggctcgatctaccatgctttcctgcgcgccgggctcgagcgg
atcggctatcaggtggacctcaagggcaagcatggcacctttgagattgccggcgttccc
aaggcggtcatcggcgaattcagccagcgccgcgaggagatcctcgatcacgcaacgcgg
ctcggcatcaagtcgccggagggcctgcgcgaaatcaccaaacgctcgcgcgatcccaag
ctcgacgtcgaggaccgcgccgcgctgaagcagggctggatcgaccaggccgctgcccac
ggcttcgacggcaaggacctgcgggcagcagccgaggcgcgcgccgggatggcgtcttcg
gaaaatgctctcgagcgcggctaccgcgccattgtcgatgccgtaactggtgcccgccag
acgctgggtgcgctgctccgcccccaggaccctttagtggacaatgcgctcgcccgcgcg
gtcaagtcgccagcggaagcgcgcgcgcagctcgcggtcgcgtccgccgtccggatcctc
tccgaacgtgaggccgcatggcccgtcaatctgctcggcaagaccgcgctcgatctcggt
ctcaagggcgtcaccgtcgacctgatcgagaggcggatcgaccggctcgtgcagaaccgt
cagctcatcccgggcgtcgcgacagccgcggaccggactggccgcatggtgaccacgcag
gaggcgctgcggaccgaagagaagattcttgccgccgtcgaggaggggaaagggaagtcc
gagccaattgtggcggccgccgatgcgccgcagcgattgcaggatgccgccgaacggccg
ctcaatcctgggcagctcgccgccgcgacgatgatcctgtcatccgccgatcgtaccgtc
tcggtgcagggcgccgccggcacgggcaagtccaccatgctccaggcggtcgcgcgggtc
gccgaggaggagggcgcccggatcaccggacttgccttccagaacaagatggtcgcggac
ctcgccgaaggggcgggcatcaaggcccagacgatcgcttccttcgtgctcgccaacgag
cggttcgtgaccgagcgtgacacgctgggatatgaggctgcgcgcgagaagctcgccggt
accatgcttctcgtcgacgaaacctcgatggtgtcgtcgaacgaaatgctcaagctccac
cagatcacagcagccttgggcgtcgacaagctcgttctggtcggtgaccggcagcagctc
tcttcgatcgacgcgggcaaggccttcgccatgatccaggcgggcggcggcacgatggcg
cggatggatcagaatatccgccaacgcaccgaccaactgcgcaccgtcgcggcgctcgcc
aatatcggcaaggccggcgcggcgctgaaagtgctgggggaccgtgtcgtcgaggcgggg
gagccggccgccgctgcggccgacatgtggctcgagctctcccctggcgaacgggaggcg
accgctgtcttcgcttcgggccgcgacgcgcgcgccgtcatcaaccagcgcatccaagat
ggcctgatcgcggaagggagcgtcaagggccaggcgatccatctcactgtctttgagcgg
gtcaacaccacgcgcgaggagctgcgctatgcctcgacctaccgtcagggccagacgctc
gaggtcggccgcggcggcgcgcaggacgtcgggatcaaggcgggacgctacgacgtcctc
aaggtccacgccaacgggaaggtcgaactgtcggacggtcggcgcaggatacgcttcgat
ccccagaagctgtcgccgaccgagcagcgcgatcgcctgcagctttctgaaaagaaggac
cttcagctgcgcgaaggggaccgcatccgctggacggccaacgacaagcagcgcggcctg
cacaatgccgcgcttgcgcgcgttgtgggcgtcgatgccgatggcgtgaaggttgagact
gcggacaaggtgctcctcacgctcagcctcggtgacccgatgctatctcggctcgacctt
gcttatagccttaatatgcacatggcccaggggatcaccaccgacaaggcgatcaccgtc
atgtcgtcgcatgagcgcaacctctcgaaccagcgcctcttcaacgtcggggtcacgcgc
gtgcgcgacgagctgacaatggtcgtggacgacaaggagaagctcgcgcggcagctcgac
atgaatcccggcaacaagacctcctcgctcgagacgctcggccgcctcgatatcgacggc
aggaaggggccgggcgcgcaaccccgcgagaagttcgatcccggtccgatcgacggcgtc
aacctgtccgatcttgctcccgttccaagcgatctgccgcctctgcccgatggcgcggca
tctgcgccggccgcgaaggccccacaagcgccgcccgatctgaaacccgatcgcggcgat
ccgctgccaccgctgcccgagcgcagcctcgggctcgacttgtga

DBGET integrated database retrieval system