KEGG   Synechocystis sp. PCC 6803: sll1717Help
Entry
sll1717           CDS       T00004                                 

Definition
(GenBank) unknown protein
Organism
syn  Synechocystis sp. PCC 6803
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AAA_16 ATPase_2 AAA_22 AAA_7
Motif
Other DBs
NCBI-ProteinID: BAA17453
CyanoBase: sll1717
CYORF: sll1717
UniProt: P73413
Position
complement(965938..967473)
Genome map
AA seq 511 aa AA seqDB search
MSVLKWINVGKVSAERDDELVNYFYDNGVLNSVLTNKSSFLVLGRKGAGKTAVFRYLKEN
PHQYLSDKDILVSLSFEDYNWKVHSLLSNSETAESLAYKHSWRFVILVEVIKAYASRCAK
DGVTVPQPIAKAQTLLEKLFDHPLPSVYQLIGRKLLGLSKVKLPRAGLDLEDGSFDSVEV
SGGELSFEEVSADNDIRTALAQNVSNIIAYLEAALAKIQPCEYRTVICFDRVDEAWDNVS
LDVSRKVLAGLVSASDSLTAKYNGVVRPIIFLREDIFSVLPLNDSNKLREDCGALLKWDR
DDLFKLLLRRLSYFAQKNDVDAVEDLDGLFDKNEMRQRSKPSNYLLKRTMMRPRDMICFL
SRTIDAVKESVNDPFEETPANFDHLPVEAIYTAEPGYSEWLRQELLDEWFIQYSHIVKLL
SAIQNHASTQFTRAELESQLRALGVEFTQTGILDDLRFLFDNSVVGFKIGASTTWRYRCF
YPSQGFIESDLYKVHDGLIRALNLKEPRDAS
NT seq 1536 nt NT seq  +upstreamnt  +downstreamnt
atgagcgttcttaaatggataaatgttggcaaggtttctgctgagcgagacgacgagctc
gtcaattacttctatgataacggtgttttgaattcagtactcacaaataagtcatcattt
ttggtactgggaagaaagggagcaggcaagactgcggttttcagatatctgaaagagaac
cctcatcagtatcttagtgataaagatatacttgtttctctttcgtttgaggattacaac
tggaaagtacattctctactaagtaatagtgaaacggccgaatcactcgcatataagcac
tcttggcgattcgtgattttagtcgaagttatcaaggcttacgcctctcgttgcgccaag
gacggtgttacagtccctcaaccaattgcaaaagcccaaaccctgcttgagaaactgttc
gatcatcctctgccatcggtttaccaattaattgggcggaagttactcggactttcgaag
gtaaagttaccaagagcagggttggacctggaagatggcagctttgactccgtggaagtt
tctggcggtgagttgtcttttgaagaagtttcggcagacaatgacatccgcactgcatta
gcccagaacgttagcaatataattgcttatctggaagccgcacttgcgaaaattcaacct
tgtgaatatcgaacagttatctgctttgatcgggtcgatgaggcctgggataatgtctct
ctcgatgtatcgcggaaagtccttgctggcctagtgtccgcatctgactctctaacagca
aagtataatggcgtggttcgacctatcattttcctccgtgaggatatcttttccgtactg
ccactgaacgactctaacaaactacgtgaagactgtggcgctctgcttaagtgggatcgt
gacgacctttttaagctcttgttgcgtcgcctttcttattttgcacaaaaaaacgacgtg
gatgcggtggaggatttagatggattatttgacaaaaacgagatgcggcagcgctcaaaa
ccttccaactacctcttgaaacgaaccatgatgcgcccaagagatatgatttgtttcttg
agccgtacaattgatgctgtgaaggaaagcgttaatgatcctttcgaagaaaccccagct
aatttcgatcatctgcccgttgaagcaatttacacagccgaaccaggatattctgaatgg
cttcgtcaggaactactcgatgaatggtttatccagtactcgcatattgtaaagttactt
tctgcaattcaaaaccatgcatcaactcaattcactcgtgccgaattggaatcgcagcta
agggcactgggggttgaatttacgcaaactggaattctggacgatctccgttttcttttt
gacaactcagtggtcggctttaagattggagcgtctaccacttggcgctatcgctgtttt
tatccatcacaagggtttattgaatctgacctttataaagtgcatgatggtttaatccgt
gcgttgaacttgaaagaaccacgagacgcatcttga

DBGET integrated database retrieval system