KEGG   Synechocystis sp. PCC 6803: sll1908Help
Entry
sll1908           CDS       T00004                                 

Gene name
serA
Definition
(GenBank) phosphoglycerate dehydrogenase
  KO
K00058  D-3-phosphoglycerate dehydrogenase / 2-oxoglutarate reductase [EC:1.1.1.95 1.1.1.399]
Organism
syn  Synechocystis sp. PCC 6803
Pathway
syn00260  Glycine, serine and threonine metabolism
syn00680  Methane metabolism
syn01100  Metabolic pathways
syn01120  Microbial metabolism in diverse environments
syn01130  Biosynthesis of antibiotics
syn01200  Carbon metabolism
syn01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:syn00001]
 09100 Metabolism
  09102 Energy metabolism
   00680 Methane metabolism
    sll1908 (serA)
  09105 Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    sll1908 (serA)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:syn04147]
    sll1908 (serA)
Enzymes [BR:syn01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.95  phosphoglycerate dehydrogenase
     sll1908 (serA)
    1.1.1.399  2-oxoglutarate reductase
     sll1908 (serA)
Exosome [BR:syn04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   sll1908 (serA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 2-Hacid_dh_C 2-Hacid_dh ACT NAD_binding_2
Motif
Other DBs
NCBI-ProteinID: BAA17878
CyanoBase: sll1908
CYORF: sll1908
UniProt: P73821
Position
complement(1432976..1434640)
Genome map
AA seq 554 aa AA seqDB search
MNLAWLQGLSLGLLSPPAPALLIFRSFTMAKVLVSDSIDQVGIDILKQVAQVDVKTGLSE
AEIIDIVPEYDAIMLRSATKVTEKIIQAGSQLKIIGRAGVGVDNIDVPAATRQGIVVVNS
PEGNTIAAAEHALAMMMALARHIPDANKSVKESKWERKQFIGTEVYKKTLGVVGLGKIGS
HVAGVAKAMGMKLLAYDPFISQERADQIGCTLVDLDLLFSEADFITLHIPKTPETANLIN
AETLAKMKPTARIINCSRGGIIDEEALVTAIETAQIGGAALDVFAQEPLGESRLREFSNV
ILTPHLGASTEEAQVNVAVDVAEQIRDVLLGLPARSAVNIPGLTPDVMEKLRPYLKLAET
LGTLVGQLAGGRIDRLTVCLQGDLAEYTNSQPLVVAAIKGLLSQALRERVNYVNAAIEAK
ERGIRVIETKDASVRDYSGSLHLKATGTMGEHSATGALLSNGEIRITDVDEFPINVPPNN
YMLFTLHRDMPGIIGKIGSLLGSFNVNIASMQVGRKIVRGDAIMALSLDDPLPDGLLSEI
TKVAGIRDAYTVKL
NT seq 1665 nt NT seq  +upstreamnt  +downstreamnt
gtgaatctagcctggctccagggactgtctcttggccttttgtccccgccggccccagcg
ctattaatttttcgatcattcaccatggctaaagttttagtttctgactccattgaccaa
gtcggcattgatattctcaaacaagtggcccaagttgacgtcaaaactgggctatcggaa
gcagaaattatagacattgttcctgagtacgatgccattatgttgcgctctgccaccaag
gtgacggagaaaattatccaagcgggtagccagttaaaaatcattggtcgggctggggtt
ggggtggataacattgatgtgccggcggccacccgtcagggcattgtggtggtcaattcc
cccgagggtaacaccattgcggcggcggaacatgctctagcgatgatgatggccctggcc
cgccacatccccgatgccaacaaatccgttaaggaaagtaagtgggaacggaaacaattt
attggtacggaagtttataagaaaactttaggtgtagtggggctggggaaaattggttcc
cacgtggccggtgtggccaaagccatggggatgaaattgttagcttacgatccgtttatt
tcccaggaacgggccgaccaaattggttgcactttggtggacttagatctgctcttcagt
gaagccgactttatcactctacacattcccaaaacaccggaaaccgccaacctaatcaat
gctgaaaccctggctaaaatgaagcccactgcccggattatcaactgttcccggggaggc
attattgatgaagaagctttggtaacagccattgaaacggcccagattggtggggctgcc
ctggatgtgtttgcccaggaacccctaggggaatctcggctgcgggaatttagcaatgtg
attttaaccccccatttgggtgcttccactgaagaagcccaggtaaatgtggcggtggat
gtggcggaacaaattcgggatgtgttgcttggtttgccggcccgttcagcggtgaatatt
cccggtttaacccccgatgtaatggaaaaattgcgtccctacctgaagctggcggaaacc
ctcggtactttagtgggtcaattggccggcggccgcatcgatcgcctaacggtttgctta
cagggagatttggcggaatataccaatagtcaacccctggtggtggcggccattaaaggt
ttgctctcccaagctctgcgggaacgggttaattacgtcaatgcggcgatcgaagccaag
gaacggggcatccgggtcattgaaactaaagatgcttccgtgcgggactattctggctct
ttgcacctcaaagccaccggcaccatgggagaacattccgccaccggggccctgttgagt
aatggtgaaattcgcattaccgacgtggatgagtttcccattaacgttccccccaacaac
tatatgttgttcaccttgcaccgggatatgccgggtatcattggtaaaattggttccctg
ctgggtagctttaacgtcaacatcgccagcatgcaggtggggcgcaaaattgtccggggc
gatgcaattatggccctgagcttggatgatcctctgcccgatggtctgctgtcggaaatc
accaaggtggccggtatccgggatgcctacaccgttaagctctaa

DBGET integrated database retrieval system