KEGG   Synechocystis sp. PCC 6803: slr1409
Entry
slr1409           CDS       T00004                                 

Definition
(GenBank) beta transducin-like protein
Organism
syn  Synechocystis sp. PCC 6803
SSDB
Motif
Pfam: WD40 ANAPC4_WD40 Ge1_WD40 eIF2A PD40 DUF5711 IKI3
Other DBs
NCBI-ProteinID: BAA17638
CyanoBase: slr1409
CYORF: slr1409
UniProt: P73594
Position
1182665..1183645
AA seq 326 aa
MRIFPVFLLTFSLFLIKEEIVTAEVKVSAPVVNQSGIKLNLERQFTGSDVAINRIHFSPD
GQFLLTAAADGVGTLWTKEGEMLGQLQGQKPPMFNARLSPDRQILITTGYDGTIRLWNLQ
GELLEEQQPHRAAVADAIFSPDSQIIVTCSDDGQTKIFTRQGQEIASVLKSGTARNLAYH
PQGLLIASVSDSGSLHLINPNGKIEREISTGQGRINNVNFSPNGEQLLTSGINGSAKLWN
LAGELIHEYKVVPTGWVNSAQFYPKGEWLATASDDGTIRFWQKDGQLIYELPLVNARLTS
LSFSPDGKQLAATSSQGQVWVFNLSY
NT seq 981 nt   +upstreamnt  +downstreamnt
atgcgtatttttcctgtatttttactaactttcagcctttttttaatcaaggaagaaata
gttacagcagaagttaaagtttctgcgccggtggttaatcaatctggcattaagctaaat
cttgagcgacaatttacggggtctgatgtggctattaaccgtatccattttagtcccgac
ggacaatttttactaacggcggccgcagatggcgtgggcactttatggactaaagaaggg
gaaatgctggggcaactacagggtcaaaagccccccatgttcaatgctcgtctttccccc
gatcgccaaattttaatcaccactggctatgacggtaccattcgcttgtggaatttgcag
ggggagctactggaggaacaacagccccatcgagcagcggtggccgatgccatatttagt
cccgacagtcaaattattgtcacctgttctgatgatggccaaactaaaatttttacccgc
caaggtcaagaaatagctagtgttttaaaatcaggtacagctcgaaatttggcgtaccat
ccccagggacttttaattgctagtgtttccgatagcggttccctccatttaattaatccc
aacggcaaaattgaacgggaaatttccacaggccaagggcgaattaataatgttaacttt
agtccgaatggtgaacaattattaacttcaggcattaatggttctgccaagttatggaat
ttagcaggggaattaatccatgaatataaagttgtgcccaccggttgggttaacagtgcc
cagttctatcctaaaggtgaatggctagccaccgccagtgacgacggtacgattagattt
tggcaaaaagatggtcaattaatttatgaattaccgttggttaatgcccgcttaactagc
ttgagtttttctcccgatggcaagcagttagcggccaccagcagtcagggacaggtttgg
gtttttaatttatcttattaa

DBGET integrated database retrieval system