KEGG   Tolumonas auensis: Tola_0200
Entry
Tola_0200         CDS       T00904                                 

Definition
(GenBank) sigma54 specific transcriptional regulator, Fis family
  KO
K11914  sigma-54 dependent transcriptional regulator
Organism
tau  Tolumonas auensis
Brite
KEGG Orthology (KO) [BR:tau00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:tau03000]
    Tola_0200
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:tau02044]
    Tola_0200
Transcription factors [BR:tau03000]
 Prokaryotic type
  Helix-turn-helix
   Other families
    Tola_0200
Secretion system [BR:tau02044]
 Type VI secretion system
  Imp/Vas secretion system related proteins
   Tola_0200
SSDB
Motif
Pfam: Sigma54_activat Sigma54_activ_2 HTH_8 AAA_5 AAA HTH_50 Mg_chelatase AAA_2 AAA_16 IstB_IS21 AAA_7 HTH_30 T2SSE AAA_3
Other DBs
NCBI-ProteinID: ACQ91830
UniProt: C4L831
Position
221430..222434
AA seq 334 aa
MTITNNKAAQRQEPDNPYALIGSSQLMKQVYRLISKVLHSEANILLTGETGTGKELVARA
IHEYGHRRTQPFVVQNCASLPDGLLESELFGYKKGAFTGADRNHLGMFDAAHNGILFLDE
IGDLPLILQAKLLRVLQEQEIRPLGDTQYHKINVRVIAATHRNLEEMVALGEFRSDLYYR
LAHFPIELPPLREREGDIKKLAYSFLREIAMRERRGEMRLSAAAEKALQNYDFPGNVREL
KSMIERAILLADDTDTIECHHFPNIQGVISPESSPVHGGMLKELVDHYERQVLIESLKKH
HGNQKNTAIALGVARRTLLYKLSKHNINSRNWRA
NT seq 1005 nt   +upstreamnt  +downstreamnt
atgacaattacaaataataaagccgctcagcggcaagagccggataacccatacgcttta
attgggagcagtcagttgatgaaacaggtttatcgcctgatttccaaggtgcttcatagt
gaagccaacatccttttaactggtgaaacaggcaccggaaaggagttggtggctcgcgct
attcatgaatatggtcaccgacgtacacagccttttgttgtacagaactgcgccagcttg
cctgacgggctattggaaagtgaactgtttggttataaaaaaggggcatttacaggtgcc
gatcgcaatcacctaggaatgtttgatgctgctcataacggcatcctgtttctggatgaa
atcggtgatctgccgttaatactgcaagcgaaattgttgcgggtgttacaggagcaggaa
attcgtccactgggtgatacgcagtatcacaaaatcaatgtccgggtgattgccgcaacg
catcggaatctggaggagatggttgcactgggggagttccgcagcgatctctattaccgg
ttagctcattttcctattgagttaccgccgttgcgggaacgggaaggtgacataaagaaa
ttagcctattcatttctccgtgagattgccatgcgtgaacgtcgtggagaaatgaggttg
tcagccgctgctgaaaaagcattgcagaattatgacttcccgggaaatgtccgcgagctg
aaaagtatgattgagcgagcgattttgctggctgatgataccgataccattgaatgtcat
catttccctaatattcagggcgttatatcaccggaatcatcacctgtacacggtggcatg
ctgaaagaactggtcgatcattatgagcggcaggtgttgattgaaagcctgaaaaaacat
catggtaatcagaaaaatacggctattgcactcggtgttgcccgccggacactgctctac
aaactcagtaaacataacattaattcccggaactggagggcatga

DBGET integrated database retrieval system