KEGG   Tolumonas auensis: Tola_2426
Entry
Tola_2426         CDS       T00904                                 

Definition
(GenBank) UvrD/REP helicase
  KO
K03657  DNA helicase II / ATP-dependent DNA helicase PcrA [EC:3.6.4.12]
Organism
tau  Tolumonas auensis
Pathway
tau03420  Nucleotide excision repair
tau03430  Mismatch repair
Brite
KEGG Orthology (KO) [BR:tau00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03420 Nucleotide excision repair
    Tola_2426
   03430 Mismatch repair
    Tola_2426
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:tau03400]
    Tola_2426
Enzymes [BR:tau01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.4  Acting on acid anhydrides to facilitate cellular and subcellular movement
    3.6.4.12  DNA helicase
     Tola_2426
DNA repair and recombination proteins [BR:tau03400]
 Prokaryotic type
  SSBR (single strand breaks repair)
   NER (nucleotide excision repair)
    GGR (global genome repair) factors
     Tola_2426
   MMR (mismatch excision repair)
    Other MMR factors
     Tola_2426
SSDB
Motif
Pfam: UvrD-helicase AAA_19 UvrD_C Viral_helicase1 UvrD_C_2 AAA_30
Other DBs
NCBI-ProteinID: ACQ94021
UniProt: C4L9R8
Position
complement(2651101..2652915)
AA seq 604 aa
MPSRSFSTAYLAQAAELAGNPGQLAAYNSQGHCVVLAGPGSGKTKTLVLKLARILAEDVQ
APRGAACITYSQECARELTRRLEMLGLREAPNLFIGTVHGFCLRHLLMPYGRLADLPIQF
PLSVASQRVSDRLIRQSGDELFGANHPYKAIDLGRHRRSVLNRNSVAWRSEEELAAWAEA
YEAALRQGGLIDYDDMVVYGQRLIAEHDWVLPLVQAKFPVLAVDEYQDLGVALHRIVKRL
AFDGGVRLFAVGDADQSIYGFTGADGALLMELAEREDIEPVRLQLNYRSGAGIVSASEMA
LGEDRGYRANDPTRQATIEFVLCPDGLADQAAHAVAQIIPVALDSKPGRTLGDIAILYTD
YRAGDIVAKAVAAGGFDYIRVDTAAPYRKVALTSWVEDCAAWCAGGWRIARPQLRGLIDR
YLAFHRANLDDAQARREGQELTALLWALRADQQSARDFVASLRNGILDRLLVAESSLADQ
KEQLDRMTAALAEGGALATLDIASLGGRDGSPDHLNLLTLHSAKGCEYDVVIMVGLDYGS
LPWRKLSPEKLRESRRLFYVGLTRARDEVHMLYSGFVEGRYGPMRHGRSPFLDELEARMR
AANL
NT seq 1815 nt   +upstreamnt  +downstreamnt
atgccgtcgcgtagtttcagcacagcctacctggcccaggctgccgagctggccggaaat
cctggtcagttggcggcgtacaactcccagggacattgcgtggtgctcgccggccctgga
agcggaaaaaccaagacgcttgtgctgaagctggctcgcatcttggccgaagacgtgcag
gcaccgcgtggtgctgcgtgcatcacctacagtcaagagtgcgcacgcgaattaacccgt
cggcttgaaatgttggggctgcgggaggcgccaaacctgttcatcggcaccgtccacgga
ttctgcctacgccatctgttgatgccatatggacgcttagctgatctaccgattcagttt
cccctctcagtggcatcccagcgagtgagtgatcgtttgatcaggcagtccggagacgag
ctctttggggccaaccatccttacaaagctatcgatcttggacggcatcgccgatccgta
ctgaaccgaaacagcgttgcctggcgtagcgaggaagaacttgccgcctgggccgaagcc
tacgaggcggcactgcgccaaggggggctgatcgactacgacgacatggtggtctatggc
cagcgcctgatcgctgagcatgattgggtactgcctctggtgcaggcgaaatttccggtg
ctggcggtagatgaatatcaggatttgggggttgcactccatcgcatcgtcaagcgcctg
gcttttgatggtggcgtgcgcttgttcgcagtcggtgatgcagaccagtcgatctacggt
ttcacaggggccgatggcgcgttgctcatggagctagctgagcgtgaagacatcgagccg
gtcagacttcaattgaattatcgctcaggggcaggcattgtcagcgcttcagaaatggcg
ttgggtgaggatcgtggctatcgggcgaacgacccgacccgtcaggcgactatcgagttt
gtgctgtgccctgatgggctcgcagatcaggccgcacacgccgtcgcgcagatcattccg
gtggccttggactccaagccaggacgaacgctgggcgatatcgcaatcttgtatacggac
tatcgcgcaggcgatattgtggccaaggccgtggcagccggcggtttcgattatatccgc
gtggacaccgccgcgccttaccgtaaagttgccttgacgagttgggtagaagactgcgcc
gcatggtgtgcgggtggctggcgtatcgcgcgtccgcaactgcgtggattgatcgaccgt
tatctcgcatttcatcgagcgaacttggacgatgcgcaggctcgacgcgaggggcaggag
ctaaccgctctgttgtgggcgttgcgcgccgatcagcagtccgcacgtgattttgtcgca
tcactgcgcaacggcatcttggatcgtctgttggttgctgaatcgtcgcttgccgatcag
aaggaacaactggatcgcatgacggcggcgcttgccgaaggtggcgcgctggctacgctg
gacattgcgagtctgggcggacgtgatggttcgccggatcacctgaacctgctgacactt
cattccgctaagggatgcgagtacgacgtggtcattatggtcggtctcgactatgggagt
ttgccatggcgaaaactgagtccagagaagttgcgcgagagtcgccggctgttctatgtg
ggactcacacgcgcccgcgacgaggttcacatgctgtactcgggattcgttgaagggcgc
tatggtccgatgcgccatgggcgctcaccattcctggatgaattagaggcacgaatgcgt
gctgcgaacctctga

DBGET integrated database retrieval system