KEGG   Tolumonas auensis: Tola_2429
Entry
Tola_2429         CDS       T00904                                 

Definition
(GenBank) conserved hypothetical protein
Organism
tau  Tolumonas auensis
SSDB
Motif
Pfam: Apolipoprotein THOC7 Baculo_PEP_C Phage_Mu_Gam ABC_tran_CTD
Other DBs
NCBI-ProteinID: ACQ94024
UniProt: C4L9S1
Position
2655475..2656134
AA seq 219 aa
MSAVAHASRSRAAFVLYLLLWAWMVGLSALVLVNFRVAGDLAGQSQVDSALRQLQVLEGR
LAEFADDVQTLQARPEAATTAALQEALQDTRQRLEADIARLEQSLAGYATEAALQTLHSE
VEQLKAQRQTAARTPAAPRPARATTTAPAQVPFPFRLIGAELRAGQRAVSIAPATDPLSA
GQIQVLLPGEHAGRWQLQTIDGNTAVFQAGDQTRRLAIP
NT seq 660 nt   +upstreamnt  +downstreamnt
atgagcgcagtggcccatgcgtcgcgttcgcgcgcggccttcgtgctgtacctgctgctg
tgggcctggatggtcggactcagcgcactggtgctcgtcaacttccgcgttgcgggcgac
ctggccggtcagagtcaagttgattcggccttacgccaactgcaggtgctcgaaggccgg
ctcgccgaattcgccgacgacgtacagacgctgcaagcccgccccgaagcggcgaccacg
gcagctttgcaggaagctttgcaggacacccgccagcgcctcgaagccgacatcgcccgt
ctcgaacagtcgctggccggctacgccaccgaggcggccctgcagacactgcacagcgag
gtcgagcagctcaaggcacagcgccagaccgccgcgcgcacgcccgcagcgccgcgtccc
gccagggcgacgacgacggcaccggcacaggtgccgtttcccttccgcttgatcggtgcg
gaactgcgcgccgggcagcgcgccgtttccatcgcccccgccaccgacccgctctcggcc
gggcagatccaggtgctgcttcccggcgagcatgccgggcgctggcagttgcagaccatc
gacggcaacaccgccgtgttccaggccggtgaccagacgcgccggctggcgattccttga

DBGET integrated database retrieval system