KEGG   Tolumonas auensis: Tola_2442
Entry
Tola_2442         CDS       T00904                                 

Definition
(GenBank) putative secreted protein
Organism
tau  Tolumonas auensis
SSDB
Motif
Pfam: DUF2046 UPF0242 Crescentin CENP-F_leu_zip YabA Mod_r Golgin_A5
Other DBs
NCBI-ProteinID: ACQ94037
UniProt: C4L9T4
Position
2665425..2666834
AA seq 469 aa
MRSNGLLKWLVLPVALLVLFFGIRLFSGGGDQPPTSVDAEPQLTAEEMQALGIEGDTPRD
TVATLVAQVRQLRTELQTATADNRTQREENQRLRQRESAIDQRIGTALEAERTALRRDQE
QLAGERRQTEGLLQDLQRRLENIGGGGHADLPVGLGLREGDGDGFAGEGGIRWVEPDDAR
QTDGRGGAGTSLSFPTSFGPAQKTLEATVGHVADAGARAAGVKTAQAVYTVPTNSTLMGS
VAMTALIGRVPVDGTVNDPFPFKVLVGPDNLTANGIDIPDVAGAVFSGTASGDWTLSCVR
GQVRSITFVFHDGTVRTIPEDSERSSQQNNQQDGLGWISDPYGIPCVSGERRSNAQQYLG
TQALITAAGAGVASLIDSDSGQMSYVGADGSIGTVGISTNEAVGRILAGGVQDMSQWVNR
LYGQAFAAVYVQPGAQVAVHLEKPLEIDYDPEGRRVDHRAGEAHALELD
NT seq 1410 nt   +upstreamnt  +downstreamnt
atgcgcagtaacggcttgctcaaatggctagtgcttccggtcgccttgctggtgctgttc
tttggcatccgcctgttctccggcggcggcgaccagccccccaccagcgtcgatgccgaa
ccgcagctcaccgccgaagaaatgcaggcgctcggcatcgagggcgatacgccccgcgat
acggtcgccaccctggtggcgcaggtgcggcagttgcgcaccgaattgcagacggccacg
gcggacaaccgcacccagcgcgaggaaaaccaacgcctgcgccagcgcgaaagcgcgatc
gaccagcgtatcggcacggcgctggaagccgagcgcaccgcattgcgtcgcgaccaggag
caactggccggcgagcgccggcagaccgaaggtctgttgcaggatctgcagcgccggttg
gagaacatcggtggcggcggtcatgccgatctgccggtcggattgggtttgcgcgaaggt
gacggcgatggtttcgctggcgaaggcggtatccgctgggtggagccggatgacgccagg
cagaccgacggacgcggcggcgcgggtacaagcctgagcttcccgaccagcttcggaccg
gcacagaaaacgctggaggccaccgtcgggcatgttgccgatgccggtgccagggctgcc
ggcgtcaagacggcccaggcggtctacaccgtaccgacgaactccaccctgatgggatcg
gtcgcgatgaccgcattgatcggccgtgtcccggtcgatggcaccgtcaacgacccgttc
ccgttcaaagtcctcgtcgggccggacaatttgaccgccaacggcatcgacatcccggat
gtggctggcgcggtgttcagtggcactgccagcggcgactggaccttgtcctgcgtcagg
gggcaggtacgtagcatcacgttcgtgttccatgacgggactgtgcgcacgattcccgaa
gacagcgagcgcagcagccagcagaacaaccagcaggatggcctgggctggatcagcgat
ccgtatgggattccttgtgtcagtggcgaacgccgcagtaatgcgcagcagtatctcggt
acccaggccttgatcaccgccgcgggcgcgggcgtcgcttcgctgatcgactccgacagc
ggccagatgtcctatgtcggtgccgatggctcgatcggcacggtcggcatcagcaccaac
gaggcggtcggacgcatcctcgccggcggcgtgcaggacatgtcgcagtgggtgaaccgg
ctctacggccaagccttcgcggcggtctatgtccagcccggcgcacaggtcgccgttcat
ctcgaaaaaccccttgagattgactacgaccccgaaggccgccgcgtcgaccatcgcgca
ggagaagctcatgcactcgaactggattaa

DBGET integrated database retrieval system