KEGG   Tolumonas auensis: Tola_2475
Entry
Tola_2475         CDS       T00904                                 

Definition
(GenBank) Poly-beta-hydroxybutyrate polymerase domain protein
  KO
K03821  polyhydroxyalkanoate synthase subunit PhaC [EC:2.3.1.-]
Organism
tau  Tolumonas auensis
Pathway
tau00650  Butanoate metabolism
tau01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:tau00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00650 Butanoate metabolism
    Tola_2475
Enzymes [BR:tau01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.-  
     Tola_2475
SSDB
Motif
Pfam: PhaC_N PHBC_N Abhydrolase_1
Other DBs
NCBI-ProteinID: ACQ94069
UniProt: C4LA94
Position
2704688..2706439
AA seq 583 aa
MTKNKKGNTSSTIVPALDMQAHMAWAQAWSSISPESSLLAWTDWASHLANSPGKQSELLS
FAGSLSEQWMSLLKKSLVSPDQEVASPEPSPTNDRRFNDPAWDQWPYNLFRSSFLIQSKW
WEQATQGVWGVDPQHERLLAFGAKQWLEMVSPTNSALFNPVVLKKTIEEQGANLARGMSN
FLDDLRRQLSGEPPAGTENFVVGRDVAVTEGKVVLRNQLIELIQYTPTTEKVHPEPILII
PAWIMKYYVLDLSPHNSLIRYLVAQGHTVFCISWRNPDAEDRDLGMDEYLEFGLRAALDA
VTSIVPEQGIHAAGYCLGGTLLAIGASAMARDGDTRLVSVSLLAAQTDFSEPGELSLFIN
ESQVALLEASMAQTGYLTSDQMSGAFQLLRSYDLIWSRMIDEYLLGDRRPMTDLMAWNAD
GTRLPAKMHSQYLRRLYLNNDLSAGRYPVLGRPVSVGNITVPMFCVGTASDHIAPWRSVY
KLHLLSSAELTFVLTTGGHNGGIVSEPGRGKRQYQIHTRAVNEGYMAPDEWQATAQTHLD
SWWPAWSAWLRERSGEGVAPPLMGAESRGYPTICDAPGKYVRS
NT seq 1752 nt   +upstreamnt  +downstreamnt
ttgacaaaaaacaagaaaggtaatacttcatcgacaatcgttccggcactggatatgcaa
gcgcatatggcttgggcccaggcttggtcctcaatttcacctgaatcgtcgctgttggct
tggacggactgggcaagccatttagcgaacagccccggaaagcaatcggagcttttgtct
tttgcaggctccttgtctgagcaatggatgtctctgctgaaaaagagcttggtcagtccg
gaccaggaagttgcatctcctgaaccgtcacctaccaatgaccgtcgtttcaacgatccg
gcatgggatcaatggccctacaaccttttccgcagttcctttcttattcaatccaaatgg
tgggagcaagccacgcaaggtgtatggggtgttgatccacaacacgaacgcctattggcg
tttggcgcaaagcaatggctggaaatggtatcgccgaccaattctgcgctttttaacccc
gttgtcctgaaaaaaacgatagaagaacaaggcgccaacctggcgcgtggcatgtccaac
tttctcgatgacctgcgccgacaactatccggtgagcctcctgcgggaaccgagaacttc
gtcgttgggcgcgacgtggcggtgacggaaggaaaagtcgtactgaggaatcaattaatc
gagttgattcaatacacgcccactaccgagaaagtccatcctgagccgatactgatcatt
cctgcctggatcatgaagtactacgtactcgatctatctccccataactcgctgatacgg
tatctcgttgcacaaggccatacggttttttgcatctcctggagaaatccggatgctgag
gatcgagatttgggcatggatgagtatcttgagttcggcttgcgtgcggcgctggacgcc
gtgacatccatcgtccccgagcagggaatccacgcggctggttattgcctgggcggaacg
ctactggccattggtgcttcagccatggcgcgtgatggcgatacgcggctggtgtcggta
agcctgcttgccgcacagacggacttcagcgaaccgggcgagctgagtcttttcatcaac
gagagtcaagtggcgctgttggaagccagcatggctcaaaccggttatttgacctccgac
cagatgagcggagcttttcagctactgcgctcctacgatctcatatggtctcgcatgatt
gacgaatacctattgggcgatcgccggccaatgaccgacctgatggcttggaatgccgat
gggactcgcctgccggcgaagatgcattcgcagtatctccggcgcctttacctgaataat
gatctcagcgcagggcgctatcccgtcctgggtcgtccggtttcagtgggaaacatcacc
gtaccgatgttttgcgtcggcactgcctccgatcatattgcgccgtggcgctccgtttac
aagctgcatctcctgtcttcagccgaactgacttttgtattgaccaccggagggcacaac
ggcggcatcgtgagcgagcctggccgaggcaagcgccagtatcaaatccatacgcgcgcc
gtgaatgaggggtacatggcgccggacgagtggcaagccactgcacagacgcatctagat
tcgtggtggccggcatggtcagcatggcttcgagagcgctctggtgaaggtgttgcgcct
ccgctcatgggggccgaatcccgtggatatcccactatttgcgacgccccggggaaatat
gtacgcagctga

DBGET integrated database retrieval system