KEGG   Tolumonas auensis: Tola_2484
Entry
Tola_2484         CDS       T00904                                 

Definition
(GenBank) transcriptional regulator, XRE family
Organism
tau  Tolumonas auensis
SSDB
Motif
Pfam: HTH_3 HTH_31 HTH_19 HTH_26
Other DBs
NCBI-ProteinID: ACQ94078
UniProt: C4LAA3
Position
complement(2715618..2715911)
AA seq 97 aa
MQKRPISQGRPPGTTTFEAEPALAFGKAVRATRLEQGVGQEKLAGLAGVARSHMGKIERG
EHMPTLALILKIAAALGISAAELMAVTERNLGSGTDS
NT seq 294 nt   +upstreamnt  +downstreamnt
atgcagaagcgtccaatttcacaaggccgtcccccaggcacaaccacatttgaagccgag
ccagcgctggccttcggaaaagcggtgcgtgccacacgcctggaacaaggagtcggtcag
gaaaagctggcaggcttggctggggtcgcgcgctcgcacatgggcaagatcgagcgtgga
gagcatatgcctacgctggctctgatactgaaaattgccgccgcgctcgggataagtgct
gccgaactgatggctgtaacagagcgcaaccttggttcaggcaccgattcttga

DBGET integrated database retrieval system