KEGG   Tolumonas auensis: Tola_2488
Entry
Tola_2488         CDS       T00904                                 

Definition
(GenBank) ribosome small subunit-dependent GTPase A
  KO
K06949  ribosome biogenesis GTPase / thiamine phosphate phosphatase [EC:3.6.1.- 3.1.3.100]
Organism
tau  Tolumonas auensis
Pathway
tau00730  Thiamine metabolism
tau01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:tau00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00730 Thiamine metabolism
    Tola_2488
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03009 Ribosome biogenesis [BR:tau03009]
    Tola_2488
Enzymes [BR:tau01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.100  thiamine phosphate phosphatase
     Tola_2488
  3.6  Acting on acid anhydrides
   3.6.1  In phosphorus-containing anhydrides
    3.6.1.-  
     Tola_2488
Ribosome biogenesis [BR:tau03009]
 Prokaryotic type
  GTPases
   Tola_2488
SSDB
Motif
Pfam: RsgA_GTPase MMR_HSR1 FeoB_N ABC_tran MMR_HSR1_Xtn AAA_16 AAA_29 AAA_15 cobW GTP_EFTU IIGP AAA_23 Dynamin_N Roc Arf MnmE_helical AAA_22
Other DBs
NCBI-ProteinID: ACQ94082
UniProt: C4LAA7
Position
2719878..2720912
AA seq 344 aa
MAKKPKLSHGQQRRVNANHQRRLQKPVTDVDDSLLGPALEGLVISRFGKHADIEDSNGEI
HRCNMRRTIESVVTGDHVIWRAGSEALQGISGVVEAVRPRQSVLTRPDFYDGIKPVAANI
DQIVIVSAVLPEFSTNIVDRYLVAAEHVEIPPLLVLNKIDLLDDISREQLERKLDIYRNL
GYPLLNVSCETEHGLDELQAQLKDKVSVFVGQSGVGKSSLINALHPHAKAVIGEISGQSG
LGQHTTTTARLYHFASGGMLIDSPGIREFSLWHLENERVTWCFKEFRDYLGGCKFRDCKH
GSDPGCLIREAVEQGKISAERYHNYHRILESMQDARNMRHVSRE
NT seq 1035 nt   +upstreamnt  +downstreamnt
gtggcgaaaaaaccaaaactcagtcatggccagcagcgccgggtaaatgcgaatcaccag
cgacgattacaaaaaccagtgaccgatgttgatgacagccttttaggtccggcactggaa
gggctggtgatcagtcgtttcggtaagcacgccgatattgaagacagtaacggtgaaatc
catcgctgcaacatgcgccgtaccatagaaagtgtggttaccggcgatcatgtgatctgg
cgggcaggcagcgaggccttacaggggatcagtggtgtcgtggaagcggtacgcccacgc
cagtctgtcctcacccggccagacttttatgacgggattaagccggttgctgccaatatc
gatcagatcgtgattgtctctgcggtattgcctgaattttctaccaatatagttgatcgt
tatctggtcgcagccgagcatgtggagatcccgcctctgctggtgctgaataaaatcgac
ttgctggatgatatctcccgcgagcaactggaaagaaagctcgatatttaccgcaatctt
ggttatccgctgctgaatgtcagttgtgaaaccgaacatggtctggatgaattacaggcg
cagctgaaagacaaagtcagcgtgttcgtcggacaatccggcgttggcaagtcatcgctt
atcaatgcattgcaccctcatgccaaagccgtcataggtgaaatatccgggcagtcaggt
ctggggcaacacaccactactacggctcgtctgtatcattttgccagcggtggtatgctg
atcgattctcccggcattcgtgagttttcactctggcatctggaaaacgagcgcgttacc
tggtgtttcaaagagttccgtgattatctgggcggctgcaaattccgtgattgtaaacac
ggcagtgatccgggttgcctgattcgtgaagccgtggaacaaggcaaaatttcagctgag
cgatatcacaattatcaccgcattctggaatcgatgcaggatgctcgaaatatgcggcat
gtcagccgcgaataa

DBGET integrated database retrieval system