KEGG   Tribolium castaneum (red flour beetle): 652945
Entry
652945            CDS       T01046                                 
Symbol
Torso, tor
Name
(RefSeq) receptor tyrosine kinase Torso-like protein
  KO
K12378  tyrosine-protein kinase receptor torso [EC:2.7.10.1]
Organism
tca  Tribolium castaneum (red flour beetle)
Pathway
tca04013  MAPK signaling pathway - fly
Brite
KEGG Orthology (KO) [BR:tca00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04013 MAPK signaling pathway - fly
    652945 (Torso)
Enzymes [BR:tca01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.10  Protein-tyrosine kinases
    2.7.10.1  receptor protein-tyrosine kinase
     652945 (Torso)
SSDB
Motif
Pfam: PK_Tyr_Ser-Thr Pkinase fn3 Pur_ac_phosph_N Pkinase_fungal ABC1 DUF2103
Other DBs
NCBI-GeneID: 652945
NCBI-ProteinID: NP_001034536
UniProt: Q5DM52
Position
LG7:complement(12229486..12235693)
AA seq 803 aa
MRYMVICALILTVGGRNLKNAEFNGLPEEKLLDALCQSFRKQNSSSCGNGNRCDLWSEKF
PIQELKSQESLLNSIQIRCIESNMISFYLEATDDFAYFLEVSNNNFKTYSNVTTCSYYSL
DDLSEDTFYDIRLWGVSFSKKQILRSDDLAVKTTSKSLVPTPVTHIFLQNLILKENTYDA
VIKWSPNEDYSCEYNLVWIKEESIYEERISVVSGLHEATLTDLALGENYTVQIMAKSESS
PFESLKKSLNFRTPSCLETFHTLEKCRPDPPQNLVINESIIDLSQQTYNVHLMWSKPDLI
PNYYIAHFINIDPENHNKTEIFLNITGDKTNSVFEHVKLGSLYHISFMACSSAGCSQKVA
EERHKTDINITTVPSEQQWGILVLIIAPLIATLIATVTVNYYRHKQKRRDERERYFKGLD
EEKLPESGENIEINLIKPDIFDQWELGPLKLSFQGVIGEGAFGIVRRAFLDLKEDNKTQV
AVKMLKESPTSEEIRQFTQEINIMKSVRQHPYIVSLIGCVTEGRAEGPLLVVEYCSRGDL
QTYLRTAWDKFTNMQQQFAYIDESSNSSNYFANKTYDFHNMSFENDFIIQPKHLLSIARQ
VALGMEHLAKTRVVHRDLAARNVLVCENHTVKVSDFGLSRDVYQDNVYCKNGGGKLPVRW
MALESLTHQRYTTYSDVWSFGVLLWEIVTLGGTPYVGVHSSELLDFLKSGNRLARPANCS
PDLYAVMLNCWKECPKNRPTFTELSKSLEGLLENVAQYLQIENVEQTLNHEIKKVIPGRI
TQKSCSTKRYVTPVNTLVRGISN
NT seq 2412 nt   +upstreamnt  +downstreamnt
atgaggtatatggtgatttgtgcgttaattttaacggtaggtggacggaatttaaaaaat
gccgaatttaatggcttgcccgaggaaaagctattagacgcactgtgccaaagttttcgc
aagcaaaattcttcttcctgtggtaatggtaacagatgcgacttgtggagcgagaagttt
cctatacaagaactgaagtcacaggaatcgttattaaactcgatacaaattagatgcatt
gaaagtaatatgatcagtttttatctggaagcgacagatgactttgcttatttcctggaa
gtttcaaataacaactttaaaacttatagcaatgtgaccacgtgtagctactactctctg
gatgatttaagcgaagacacgttttacgatattcgactgtggggggtctcattttcgaaa
aaacaaattttacgcagcgacgatctcgctgtcaaaacaacaagcaaaagtttagtccca
acaccagtcacgcatatttttcttcaaaatctaattttgaaagaaaacacatacgatgcc
gtaattaaatggagtccaaatgaagattattcgtgcgaatataatctcgtgtggattaag
gaagaatccatttatgaggaaaggataagcgttgtttcaggtttgcacgaagcgactttg
accgatctggctttaggggaaaactacactgtgcaaattatggcgaaatcggaaagctcg
ccctttgagagtttgaagaaatcgcttaatttccgcaccccttcttgcttggaaactttc
catactttggaaaaatgccgccctgatcccccacaaaacctggtcattaacgaaagtatc
atcgatttatcccagcaaacatacaacgtccacttgatgtggtcaaagccagatttaata
cccaactattacatcgcccattttattaacattgacccggaaaatcacaacaaaaccgag
atttttttaaacataactggggacaaaacaaattcagtttttgaacacgtgaagttgggt
tccttgtaccacatctccttcatggcctgttcgtcggctgggtgcagtcaaaaagtggcc
gaagagcggcacaaaaccgacataaacatcacaacagtcccctcggagcagcagtggggg
attttggtcctaattatcgcacctctaattgcaactttgattgcgacagtgactgttaat
tattaccgacataagcagaagcgacgcgatgaaagagagcgctatttcaagggtcttgac
gaggagaagcttccagagtcgggggaaaatattgaaatcaatttgatcaaacccgacata
tttgatcagtgggagctcggtccccttaaactttcctttcagggcgtcatcggagaggga
gctttcgggattgttcggcgagctttcctagacttgaaggaagacaataagacacaagtt
gctgtcaaaatgctgaaagagtcacccacttcggaggaaatacgacagttcactcaagaa
atcaatataatgaagtcggtgagacaacatccatatattgtttccttgatcggctgtgtg
acggaaggacgagccgaagggccactgctggtggtcgagtactgctcaaggggggacctg
cagacttacctcaggacggcctgggacaaattcaccaacatgcagcaacaatttgcatac
attgacgaaagctcaaacagttcgaactatttcgctaacaaaacttacgacttccacaat
atgagcttcgagaacgattttataatccagcccaagcaccttttatcaatagcgcgccaa
gtggcgctcgggatggagcatctcgctaaaactcgtgtcgtgcaccgcgatctggcggca
cgtaacgttctagtttgcgaaaatcacacagtgaaagtgtccgactttggtctgagtcgc
gacgtttaccaggacaacgtttactgcaaaaacggcggcggaaaattgccggtcaggtgg
atggccctagaatctctaacgcatcagaggtacaccacgtatagcgacgtctggtccttc
ggcgttttactatgggagatagtaacgctcgggggaaccccctacgtgggtgtacactcg
tccgaactgctggatttcctcaagagcggaaatcggttggcgcggcccgcgaattgcagc
cccgacttgtacgccgtcatgttgaattgttggaaggaatgtccgaaaaacaggccgact
tttaccgaactgagcaaatctctggagggtttgttggaaaatgtggctcagtatcttcaa
attgaaaatgtcgaacagaccctcaatcacgagattaaaaaagtgattcctgggagaata
acccaaaagtcgtgttccaccaaacggtatgttacacccgttaatactctagtcagaggt
attagcaactaa

DBGET integrated database retrieval system