KEGG   Tribolium castaneum (red flour beetle): 655704
Entry
655704            CDS       T01046                                 
Name
(RefSeq) dynein heavy chain 2, axonemal
  KO
K10408  dynein axonemal heavy chain
Organism
tca  Tribolium castaneum (red flour beetle)
Brite
KEGG Orthology (KO) [BR:tca00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   03037 Cilium and associated proteins [BR:tca03037]
    655704
   04812 Cytoskeleton proteins [BR:tca04812]
    655704
Cilium and associated proteins [BR:tca03037]
 Motile cilia and associated proteins
  Dynein arm
   655704
Cytoskeleton proteins [BR:tca04812]
 Eukaryotic cytoskeleton proteins
  Microtubules
   Tubulin-binding proteins
    Dyneins
     655704
SSDB
Motif
Pfam: AAA_6 DHC_N2 DHC_N1 Dynein_C AAA_9 AAA_7 AAA_lid_11 MT Dynein_heavy AAA_8 Dynein_AAA_lid AAA_5 AAA_lid_1 AAA AAA_22 Sigma54_activat
Other DBs
NCBI-GeneID: 655704
NCBI-ProteinID: XP_015838947
Position
LG9:8506770..8560439
AA seq 4272 aa
MTTPSPLDEAEEKDSLFSDKSEDKAVKIQTPEAETSEHVKVSYTDEDLDKLVGFVRNLTT
LYDLRPDDWKEENYEVIKRFFLTPTEPILTIYFVNDDLICSLGPPVKSVMDLTYFLRQPF
EVFEVATFFDNINFGTMDDNIEGSILNIVENIYAPVFFKSNHWPESVKNDFSHNLHMFLS
KFTDVHSRLFGLTVLYIPREALDIPVDVASLDKELVKRMEAIVVYWTKQIRVGLQDQDQN
TPDDLLTPLDEYDFWVYRFENLSGLNYQLTNESLKHICNILIAVQSTYVHQFLILADEIE
RNVKESMSNIEYLAVLRKPCTELSEIENPNEMHTKLAEILHLIRFIWMNSPYYNTIEKIT
SLCRALSNQVILQCTKYINMDILFEEKKSREGIKMFETCIECLTNYIRTYVLISESHTMF
GPSPWLLDKAPIFNHVDSFIQRCKDMIEICEAMINFGRHDETEEIPKPNFGGSRRIEFLN
WCNKVEDMFAESLKSVQEVKHLILDVQVSTWYDQMLQFKNRMKDIEVVIENLTNAVFEEV
ANVEEGIESLAALYNYSKRESLKALFDGKTLFVYEMFKEEIHGVKKELTESEMYPARLPY
YAGRAMIANMKKNRLVLIRKFFDDAKWMLPCSVSQEIFSQYEKLVSSIDERILGLYRKWN
DRLGEDVAKRLHRPLMCKSISKPGLLECNIDRSLLEIFTEARYWESLNYEVPSHIKSVYD
KANNVRFVYESVLAVVLDYNKILASLSDDERLLFKPLITIVEKKIAPGLSKLTWASEVSD
EYIAECSHNTAELQQFLDDYKSCNLQIVTICEKVCDTYMFRITPNYVFNIRELIIEISTQ
LEKTMEKLVIHYQNIIQFLILVFEGFENYMTVMANQWITYINNFDTLVEEALKISCRNTL
NHMYECLHGDDTLGPNPVLELTASLKANRINFEPTLSEVAKVVHNILPNMVEALTTLPRL
NDKFHVAETDFTPYWGIIEQDAECQKIQKMLNDEMSLNVKKIQEYMTIWEPFRDLWEIDK
DLFMTKYETENPTAAQFDANIGRYTEVANNVQIQEGVTVVHFIRINCSELKKSIIEHCLQ
WQMKLCQLLYKLTVRNIDDVYEYIKVNTEAVLKEPQNLIEMEKAIALHERLVNEVSQKEE
TFPFITDQMLVLEKYNVSVSNEVRNREKAIPNEWSRYLDVLSDADKMLGYSKDTFKTRLL
EDAEVLKKDGKKLLDDFLATGPFSSDWSAEDALKYIADIKAKLAYLREHEKDLRGDLGIF
GLSLPDTIELTKLEREIAAIELVWQLTDEWNKAWEKYKSGEFWTIETEEMEVTAQTLFRK
LTRLSRELKDKNWEIVDHTRQRVDAFRRTLPLIGDLKNPSMRPRHWDRVRKVVGKDFDEN
GPEFNLEAIYAMEMHKYAEEINDISNAATMELQIEKGLANIAHIWKDIKIEMVPHKDKGL
YRIKSVEECFQTLEDHMLQLSTMKSTRFVEPFAKEVDYWERTLSYILETLEAALTVQRQW
LYLENIFFGEDIRKQLPRESEGFDRLSEEWKNITIHMHAGKTAMKATQYEPAPYLYNKLN
RMNDKLELIQRALERYLETKRHIFPRFYFISNDDMLEILGNSKKPEAVQPHLKKLFDNLT
KLKMQRNLVTGKQEAMGMFSEDGEYMDFTKLIVLDGPVEMWLLEVEAQMRAALKKEFKPC
RSALKKMLSKRDKWLLSYCGQLCNACSQIQWTTDCTKALVHAKITDSKKPLKKLRKKQNQ
VLSKLSELSRRELTKLQRLKANALITIEIHSRDVIDKMYKANCRDTNSFEWFSQLRFYWD
RDLDDCVIKQTNTAFMYGYEYNGNSGRLVITPLTDRCYITLTTALHLFRGGSPKGPAGTG
KTETVKDLGKAMGMWVIVNNCSEGLDYKSMGKCFSGLAQTGAWGCFDEFNRINIEVLSVV
AQQILSILSAIARKMKQFVFEGTEINLKLTCGIFITMNPGYAGRTELPDNLKSMFRPISM
MVPDSAIIAENILFSDGFQNTKTLSKKVFTLYQLAMQQLSKQDHYDFGLRSMVALLRYGG
RKRRQFPHFPEDEIIYLAMRDMNIARLTSDDLPLFNGIMSDIFPGVSIPKVDYVDMTDAI
VSHMKENGLQPIENAITKIIQLYETKSSRHSVMILGQTGSAKSTTWKTLQGALGILHKAG
KPGFNVVHVYAINPKALNLGELYGEYNLSTNEWLDGVISAVMRTTCAEETPDEKWILFDG
PVDAVWIENMNSVMDDNKILTLINSDRITMPEQVSLLFEVGDLSVASPATVSRCGMVYND
YKDWGWLPYVTSWVQKQHKRGKEFQDIMMDFFHVYLQKILDFKRLHCEEAAGCVELNLVM
SLCKLLEILATVENGVNPHDEDNFADMAKNWFLFCLIWSVCCTTNEEGRKKIDNFIREKE
GVFPIKDTIYEYFVDVPNKSFALWEVKLPYDWKYDPGCAFFEIIVPTVDTVRYEYITNAL
LSHGYPVLLTGPVGTSKTSTAQSVLASLSSEKYTVLNINMSAQTSSLNLQEAIESRLEKR
TKGVYAPVGGKLLITFLDDLNMPAKETYGSQPPLELLRQWLDYNFWYDRQKQTKKFVINM
HILAAMGPPGGGRNVISERLLSIFNVINITFPDETNILRIYGTMLGQHLADFNEVVKIVG
REITETTIDLYNNVTAKMLPTPTKIHYLFNLRDISRIFQGLLRIKSKLANAAKKAGVFPT
SEAMYNFLIKRVRANLHIIICMSPIGDAFRNRLRQYPALVNCTTIDWFCEWPKVALLEVA
NKYITDVNFVQTITGEVLGKRRASVLLSSQDRLREAVASTFATIHDSVAKCARRMAIEMK
RHSYVTPTNYLELVAGYKKMLQEKRDEVSAQANKLRNGLWKIEDCRNKVQSMSIELEEAQ
VKVAEFQQQCDEYLVIIVAQRKQADEQQKEVTQKSIKIREDEVQCQKLADVAQADLDEAM
PALEEAIRALDSLSKKDISEMKSYGKPPAKVEMVMEAIMILKQVEPTWAESKRQLGEINF
LKDLKDFDKNHISDRTLKKVANYTQNPEFIPEKVGTVSFAAKSLCQWVIAIEKYARVWKI
VEPKQMKFDEAMASLREKQAMLAEAQAKLAELNIMLARLQKEYEEKLEQKEELNRKAELL
KIKLERAYILVECLAGEKTRWEETVAKLDISFDCLPGDCLLATAFLSYLGPYVSNYREEL
MEMWKNEVATLEIPYSTNFEIISFLTDPTTVREWNLQGLPADGFSTENGIIVTTGQRWPL
VIDPQCQAQKWIKNMEAVNNLKVVDFGMHSYMKILEDAVQNGKPVLLQNILETMDPSLNS
ILAKAVVKQGGMNLIKIDDKMVSYNDDFRFFITTKLTNPHYPPEISTKTTLVNFAVKEQG
LEAQLLGIVVRKERPQLEEQKDKLVTAIAKGKRQLIDLENELLRLLNETRGSLLEDAELF
NTLQTSKATSIAVAKSLETAETTEVQIDMAREGYRPCAERASILFFVLNDLGRIDPMYQF
ALDSYIFLFEKSIQNSTKSQILSERIMELNDYHTYSVYRNTCRTLFEHHKLMFSFHMCVK
ILENMGKVVKAEYNFLLRGGVVLDKENQMDNPCAAWLSDEGWDNITELDKIAGFHGIIDT
FEQYPREWHAWYTHTEPETLPLIAEWNEICNNFQKMLFIRSLRQDRMSFCITNFIINQLG
SKFVEPPVLDIKAVLEESVAQTPLIFVLSPGVDPTTALMQLAESAGMMGAFQSLSLGQGQ
SPIATRMIQRGAKEGHWVFLANCHLSLSWMPQLDKIVETLQTGKINPRFRLWLSSSPHPE
FPISILQAGMKMTTEPPKGLRANLTRLYQLITEEQFSVCQCQEKYKKLLFSLCFFHAILL
ERKKFQQLGWNVIYSFNDSDFEVSENLLTIYLDEYENTPWDALKYLIAGVNYGGHVTDDW
DRRLLLTYINQYFCDDVLNIPYHRLSSLPTYYIPRDGSLQTYQDYVRLLPTIDRPEAFGQ
HPNADITSLITESRMFCETLMSLEIQSSSGESESQEDKVSQLAAEVLSKIPNPIDYETTE
KLIGVDKKPLDVVLLQEILRYNTLLVDIRTSLDELQKGIKGLVVMSSQLEEIFTCIFEGR
VPSDWLKAYASLKLLGSWTRDLIARVEHFETWASTTHPPMFFWLSAYTFPTGFLTAVLQT
TARANEVPIDTLSWEFTVITVDESQLIERPENGVYVKGMFLEGAGWDRKNACLIEPQPMQ
LVCAMPVIHFKPQEVLKKKTRGLYSCPCYYFPIRTGAPNRPAFVVAVDLKSGAENADFWI
KRGTALLLSLSN
NT seq 12819 nt   +upstreamnt  +downstreamnt
atgaccaccccttcacccctcgatgaggcggaagaaaaagattcattattctcggacaaa
tctgaggacaaagccgtaaaaatccaaactcctgaagccgagacaagtgaacacgttaaa
gtctcgtacaccgacgaagatcttgacaaattagtgggttttgtcagaaatctgaccaca
ctctatgacctgcgacctgacgactggaaggaagagaactacgaagtcatcaaacgcttt
ttcctgacaccaaccgaacccattttgacgatctatttcgtaaacgatgacttgatttgc
agtttaggcccccctgtcaaatctgtcatggacctaacttattttctccgacaaccgttt
gaagttttcgaagttgcgactttctttgataacattaattttggcacaatggacgataat
atcgagggcagcattttgaacattgtggaaaatatctacgctcctgtttttttcaagtca
aaccactggcccgaaagtgtcaaaaacgatttttcgcacaatcttcacatgtttttgtcg
aaatttaccgacgttcatagcagattgtttggtttgaccgtcctgtatattccacgggaa
gctctcgacatccctgtagatgtcgcaagtcttgataaagaattagtgaaaaggatggaa
gctattgttgtctactggacaaagcaaattcgagttggtttacaagaccaagaccaaaac
acccctgacgatcttttaacccctctcgatgaatacgatttttgggtctacagattcgaa
aatttgtctggcttgaattaccaattaaccaatgagagtttaaaacacatttgcaacatt
ttaatagctgtccagtcgacttacgtccaccagttcttgattctggctgacgaaatagaa
cgaaatgtgaaagaatcaatgtcaaatattgagtatttggccgttttgcgtaaaccttgt
accgaactctctgaaatagaaaaccccaatgaaatgcacacgaaactagccgaaattttg
cacttgattcgtttcatttggatgaacagtccgtattacaacaccatagaaaaaataact
agtttatgtcgcgcgttaagcaaccaagtgatccttcaatgcaccaaatacatcaacatg
gacatacttttcgaagagaagaaaagtcgagaagggatcaagatgttcgagacttgcatc
gaatgtctcacgaattacatacggacttacgttttgatctcggaaagtcacactatgttc
ggaccttcaccttggttgctcgacaaagctccaattttcaatcacgtcgattcgtttatc
caaagatgcaaagacatgattgagatttgtgaagccatgattaactttgggcgacacgac
gaaactgaagaaattccgaaaccaaatttcgggggttcacgacgtattgaatttttgaac
tggtgcaacaaagtcgaagacatgtttgcagagagtctcaaatcggtccaagaagtaaaa
cacttgattctcgacgtccaagtctcgacatggtacgaccaaatgttgcaattcaaaaac
cgaatgaaagatatcgaggtcgtgattgagaatttgacaaatgcggtttttgaagaagtt
gccaacgttgaggaaggaatcgagagtttggccgcgttgtacaactactcaaaacgtgaa
agtttaaaggcgcttttcgacggcaaaacattgttcgtttatgagatgtttaaagaggag
attcatggagttaaaaaagagttgaccgagtctgaaatgtatcctgcgagactgccgtat
tacgccggacgggccatgatcgccaacatgaagaaaaaccgacttgtcctaatccgaaaa
tttttcgatgacgccaagtggatgcttccttgcagcgtctcgcaagagattttttcacag
tacgagaaacttgtcagttcgatcgatgaaagaattttgggtttgtatcggaaatggaac
gaccggcttggagaagacgtcgccaagcgtttacaccgccccctgatgtgtaaaagcatc
tcaaagccggggcttcttgaatgcaacatcgaccgctccttgctcgaaatcttcacagaa
gcgagatattgggagtcgttgaattacgaagtcccctctcacataaaatcagtctatgat
aaagcaaacaatgttagatttgtctacgaaagtgtcctggcggtggtcctcgattacaac
aaaattctagcttcgttgagtgacgatgagcgacttttgttcaaacctttgatcactatt
gtcgagaaaaaaattgcccccggtttgtcgaaattgacttgggcttcggaggtgtcagac
gagtatattgctgagtgttctcacaacactgctgagttgcaacaattcctcgacgattat
aaaagttgtaacttgcaaattgttacaatctgcgagaaagtttgtgatacttacatgttt
cgcataacgccgaattatgtgttcaatattcgtgaattaatcattgaaatctcaactcag
ttggagaagacgatggaaaagttggtgatacattatcagaatattatacagtttttgatt
ttggtatttgaggggttcgaaaactatatgactgtgatggcaaaccaatggattacttac
atcaacaattttgacacgcttgtggaggaagctttaaaaattagttgccgaaacacatta
aaccacatgtacgaatgcctacacggcgacgatacacttggcccaaacccagttttagaa
ctcacagcaagtctaaaagctaaccgaataaattttgagccaactttgagcgaagtcgca
aaagtggttcacaatattttgcctaatatggtcgaagccctcacgactttgccacgactg
aacgataaatttcacgtcgctgaaaccgattttacgccgtattggggaatcatagagcaa
gatgccgagtgtcagaaaatacaaaaaatgttaaatgatgaaatgagtttgaacgttaag
aagattcaagagtatatgacaatttgggaaccttttcgcgacctttgggaaatcgataaa
gaccttttcatgaccaaatacgagactgaaaatcccactgcagcacaattcgatgccaac
atcggacgatacacggaggtggcaaacaatgtgcagattcaggaaggagtcactgttgtc
catttcattcgaatcaattgttcggaattaaaaaaatccataatcgaacattgtctacaa
tggcagatgaagttgtgccaacttttgtacaaactgactgtgcgaaatatcgacgatgtt
tatgaatatattaaggtcaacactgaagcagttttgaaagaaccacaaaatttaatcgaa
atggaaaaagcaattgcgcttcatgaaagactagtcaatgaggtgtcacaaaaagaggag
acctttcctttcataactgaccaaatgttagtgctggaaaaatacaacgtttctgtctcg
aacgaagtcagaaatcgtgaaaaggcaattccgaacgaatggtcacgatatttggacgtc
ttatcagatgctgataagatgttggggtactcgaaggacaccttcaaaactagactactt
gaagacgctgaggttttgaaaaaagacgggaaaaaattacttgacgattttttggcaact
ggtcctttttcatcggactggtcagccgaggatgctttgaaatacatcgccgatattaaa
gcaaaactggcttatttgcgagaacacgagaaagatttgagaggagatttgggtattttt
gggctcagtttacccgacactatcgagctaaccaaattagaaagagaaattgctgcaatc
gaactggtatggcagctgacagacgaatggaacaaagcttgggaaaagtacaaatcgggc
gaattctggacgatagaaaccgaggaaatggaagtaaccgctcaaactcttttcaggaaa
ttgacacgactctcgcgcgaactcaaagacaaaaattgggagattgtggaccatacgagg
cagagagtcgacgctttccgaaggactttgccgctgattggcgatttgaaaaatccttcg
atgcgaccgaggcattgggatcgggttcggaaagttgtcggcaaagattttgacgaaaac
gggccagaatttaaccttgaggcgatctatgccatggagatgcacaaatatgctgaagaa
attaacgatatttcaaatgccgctacaatggaattgcaaattgagaaagggttggccaat
atagcccacatctggaaagatatcaagattgagatggtgccacacaaagataagggtctt
tacagaattaagagcgtcgaagagtgttttcaaacacttgaggatcacatgttgcaatta
tcgacaatgaaaagtacccgatttgttgaaccttttgccaaagaagtggattattgggaa
cgaacattgtcttacattttggaaacgttagaagcggcacttactgtacagagacagtgg
ctgtatcttgaaaacatcttttttggcgaagacattcgcaagcaactccctcgcgagtcg
gaaggtttcgaccgactttccgaagagtggaaaaacatcacaattcatatgcatgcagga
aagaccgcaatgaaagcaacacaatacgaaccagctccttacctttacaacaaactgaac
cgaatgaatgacaaactggaattgattcaacgagctttggaacgctacttggagaccaaa
cgtcacattttcccccgtttttattttatttcaaacgacgatatgttggagattttgggc
aattcaaagaaacccgaagctgtgcaacctcatttgaagaaactattcgacaacttaacc
aagttgaagatgcaaagaaatttggtcaccggcaaacaggaagctatggggatgttctcc
gaggacggtgaatacatggattttacaaaactgatagttttggatggtcccgttgaaatg
tggttgttggaagtcgaggctcagatgcgggcggctttgaagaaggagtttaagccttgt
cgcagcgctctgaagaagatgctgagtaaaagggataagtggttgttgagttactgtggg
cagctttgcaacgcttgcagtcagatacaatggaccactgactgtacaaaagccttagtt
catgcaaaaataaccgatagtaagaaaccgttgaaaaaattaaggaagaaacaaaaccaa
gtcctgagcaaactctcagaattgagtagacgagaactgactaaattacaaagactgaaa
gcaaatgcacttatcacaattgaaattcattcgcgcgatgttatcgataaaatgtacaaa
gccaattgcagagacacgaattcttttgagtggttttctcagctgcgtttctactgggat
cgtgatttggatgactgtgttatcaaacaaacaaatactgctttcatgtatggatacgaa
tataatggaaattccggtcgtcttgtaataacaccactaactgacagatgttacataact
ctgacaacggccctccacctgtttcggggcggtagcccgaaagggccggccggaaccgga
aaaaccgaaactgtcaaagacttgggcaaagcgatgggcatgtgggtcatcgtcaacaat
tgttccgaaggtctagattacaaaagtatgggtaaatgtttctcgggacttgcccaaacg
ggtgcttggggctgtttcgacgaattcaaccgaatcaacatcgaagtcctttcggtggta
gcccaacagattttgagcatcctatcggcaatcgctcgaaaaatgaaacaatttgttttt
gaaggtaccgaaattaatttaaaactgacttgtggtatcttcataacgatgaatccgggt
tatgccggacgaaccgagcttccggataacttaaaatcgatgtttcggcccatttctatg
atggtccccgacagtgcgataattgccgagaatattctattcagtgatggtttccaaaat
acgaaaactttgtcaaagaaagtctttactttatatcagctagccatgcaacagttgagt
aaacaagatcactacgatttcgggctccggtccatggtggccttgctccggtatggcggc
cggaaaaggcgccaatttccgcattttccggaagatgaaattatttatctagcgatgcgc
gacatgaacatcgccagacttacatcggacgacttacccctttttaacggaatcatgtcg
gacatcttccccggtgttagtatccctaaagtggattatgtcgacatgactgatgccata
gtgtctcatatgaaagaaaatgggttgcaacctattgaaaatgcaataacaaaaattatt
caattgtacgaaacgaaaagttcacgtcattctgtcatgattttgggccagactggatca
gctaaatctacgacttggaaaacgctccaaggggcactggggattttgcataaggcggga
aagcccggctttaatgtcgtacatgtctacgccatcaaccccaaggctttgaatctgggg
gagttgtatggggagtacaatttgagtaccaacgaatggttggatggagtcattagtgca
gttatgagaactacatgtgcagaggaaacgcctgacgaaaaatggattttgttcgatggt
cccgtcgacgccgtttggatcgaaaacatgaacagcgtcatggacgacaataaaatctta
actttgattaacagcgatcgcatcacgatgcccgaacaagtatcacttttattcgaagtt
ggtgacttatcagtagcctcccctgccacggtcagcaggtgtgggatggtctacaacgat
tacaaagactggggttggttgccttatgtcacctcttgggtgcagaaacagcacaaacgt
ggcaaagaatttcaagacattatgatggattttttccacgtttatttgcaaaaaattctc
gattttaaacgactacactgcgaagaggccgccggttgtgttgaactgaacttagtcatg
tctctgtgcaagcttttggagattttggcgacggtggaaaacggggtcaatccgcacgat
gaagacaattttgccgacatggccaaaaactggtttctgttctgtttaatttggtcggtt
tgttgcaccaccaacgaggaaggtcggaagaaaatcgataactttatccgagaaaaagag
ggtgttttcccgatcaaagacacgatttacgaatatttcgtcgacgttccgaacaaaagc
ttcgctttgtgggaagtgaaactgccctatgactggaaatacgaccctggatgtgccttt
ttcgaaatcattgtcccgactgtggacactgtgcgttacgaatacatcactaatgcgctt
ttgtcgcacggttatccagttttgctgactggacctgtgggtactagcaagacttcgaca
gcacagtcggttttggcaagtcttagttcagaaaaatacacggtgttgaatataaatatg
tcggctcaaacgtcttcgttgaatttgcaagaagcgatcgagagtcggttggagaaacgc
accaaaggggtgtatgccccagttgggggtaaattgttgatcacgtttttggatgacttg
aatatgccggcgaaggagacctacgggtcgcaaccgcctcttgagctgttgagacagtgg
ttggactataatttctggtatgataggcagaagcagaccaagaaatttgttattaatatg
catattttggccgccatggggccgcccggcggcggcagaaacgtgatttctgagcgtctt
ttgagcatcttcaacgtgattaacatcacattccctgatgaaaccaacattttgcgaatc
tatggtaccatgcttgggcaacatttggccgatttcaacgaagtcgtgaaaattgtcggt
cgggaaattaccgaaaccaccatagatttgtacaataatgtgacggcgaaaatgctacca
actccgacaaaaattcattaccttttcaatttgcgagacatttcgagaatctttcagggc
ctgttgaggattaaatcaaaattagctaacgctgcaaaaaaagccggcgtcttcccgaca
tctgaagccatgtacaactttttaataaagcgagttcgtgccaatttacacataattatt
tgtatgagtcctattggagacgctttccggaacagattacgccagtaccctgctctagta
aactgtacaacaatcgactggttttgcgagtggccgaaagtggccttacttgaagtcgca
aataaatacatcactgacgtaaactttgtccaaactataactggtgaagttttgggaaaa
cgacgagcttctgtcctattgtcaagtcaagacagactacgtgaagccgtggcttcgact
tttgccacaatccacgattctgtggctaaatgcgccagaagaatggcaatcgagatgaag
agacacagctatgttactccaacgaattatttggagctagttgccggctataaaaaaatg
cttcaagagaaacgcgacgaagtctcagcgcaagccaacaaactgcgaaacgggttgtgg
aaaatcgaggactgtcgcaacaaagtccagtcgatgtcgatcgaactggaggaagcccaa
gtcaaagtggcggagttccagcagcagtgcgacgaatatttggtcattatcgtggctcag
agaaaacaggccgacgagcagcagaaggaagtgacccagaaaagcatcaaaatcagggag
gacgaagtccagtgccaaaaactggccgacgttgcgcaggccgatttggacgaagccatg
ccagcgctcgaggaagccatccgagcccttgactcgttgagcaaaaaggacatcagcgag
atgaaatcgtacggaaaaccgccggcaaaagtggaaatggtcatggaagctatcatgatt
ttgaaacaagtcgagccgacttgggccgaatccaagcggcaattgggcgaaatcaacttt
ctcaaagacttgaaagactttgataagaatcacatttcagatcggacgcttaaaaaagtg
gctaattacacgcaaaatcccgaatttattccagaaaaagtcgggactgtgtcatttgcg
gcgaaaagtttgtgtcagtgggtcattgcaattgaaaaatatgccagagtttggaagatt
gtggagccgaaacagatgaaatttgacgaggctatggcgtctctgagggagaaacaggcg
atgttggccgaggcccaggccaagttggccgagttgaatatcatgttggcgagacttcag
aaggagtatgaggagaagttggagcagaaggaggagttaaatcgaaaggccgagttgttg
aaaatcaagctcgaaagggcctacattttggtcgagtgcctggccggggagaagacccga
tgggaagaaaccgtcgccaagcttgacatttcgttcgactgtttgccgggtgactgtctt
ctagccacagcatttctctcttacttaggcccctacgtgtcgaactaccgcgaagaactg
atggaaatgtggaaaaacgaagtcgcaactttggaaattccctacagcaccaacttcgaa
ataatctcctttctaaccgatccgacaacggtgcgcgaatggaacttgcaagggctcccg
gccgacggtttcagcaccgaaaacggaatcatcgtaacgacgggccaaagatggcccctc
gtaatcgacccccaatgccaggcccaaaaatggatcaagaacatggaagccgtcaacaac
ctcaaagttgtagatttcggaatgcacagctatatgaaaattctagaagacgccgttcaa
aacggcaaacctgtcctgctccaaaacatcctcgaaacgatggacccctccctgaactcg
attctggccaaagctgtagtcaagcaaggcggcatgaatttgataaaaatcgacgataag
atggtgtcgtacaacgacgatttccgctttttcattacgacgaaactgacgaatccgcat
tacccgcctgagatttcgaccaaaacgactttggtcaattttgccgtcaaggagcaaggg
ctggaggcccagcttttggggattgttgtacgaaaagagaggccacagttggaggagcag
aaagataagcttgtgacggcgattgccaagggaaaacgacaattgatcgatttggaaaat
gaacttttaaggctactgaatgagactagaggctcgctgttggaagacgccgaattgttt
aatactttgcaaacgtccaaagcgacgtcgattgccgttgcaaagagtttggaaacagca
gaaacgacggaagtgcagattgacatggcgagagagggttatagaccatgtgccgagcgg
gcttcaattttgttctttgttttgaacgatttagggcgtattgacccaatgtatcagttt
gcgttagattcgtacatatttttgttcgaaaagtcgattcaaaacagtacgaaaagccaa
attctgtctgagagaatcatggagctgaacgactatcacacgtattccgtttacagaaat
acatgccgtacgctttttgagcaccataagctcatgttttcgttccacatgtgtgtcaaa
atattggaaaatatgggcaaagtggtcaaggccgagtacaattttctgttgaggggtggc
gtggttcttgataaggaaaaccaaatggataatccctgtgcggcttggttgtctgatgaa
gggtgggataatataaccgaactggacaaaatcgcgggatttcacgggattatcgacact
tttgagcaatatcccagggaatggcacgcatggtacacccacacggagccagaaacttta
cccttaatcgctgaatggaacgaaatctgtaacaacttccaaaaaatgctcttcatccga
tcgctccgccaagaccgaatgtctttctgcatcacaaatttcataatcaaccaattggga
tccaagttcgtggagcccccagttttggatatcaaagccgtactggaggaatctgtggcc
cagactcctttaattttcgttttatcgcccggcgtagaccccactacggctctgatgcaa
ctggccgaaagtgccggaatgatgggagcgttccagtccctgagtctgggccaaggacaa
tcgccgattgcaacaagaatgattcaaaggggggccaaagagggccattgggtcttccta
gccaactgtcacttgtctctaagttggatgccacaactcgacaaaatcgtcgaaacttta
caaacgggaaaaatcaatcccaggttcaggctgtggctgagttccagtccccatcccgaa
tttcccatctccattcttcaagccggaatgaaaatgacgacagagccgccaaagggtttg
agggccaatttgacaagactgtaccaactgatcacagaagaacagtttagcgtatgccag
tgtcaggagaaatacaagaaattgctgtttagtttgtgtttcttccatgcgattctgcta
gaaaggaaaaagttccagcagttgggctggaacgtaatttacagtttcaacgattcggat
ttcgaagtttcggaaaatctattaacgatttatttggacgaatacgaaaatacgccttgg
gatgctctcaaatacttaattgcaggtgtgaattatggtggtcatgtgaccgatgattgg
gacaggaggctcctattgacttacataaaccagtatttctgtgacgacgttttaaacatc
ccataccacagattatcgtcattaccaacatattacatacctcgagatggttctcttcaa
acttatcaagactatgtccgacttctaccaaccattgatcgaccagaagcattcggccaa
catccaaacgccgatataacgtctctaatcacagaaagcagaatgttttgtgagacttta
atgtctctcgaaattcaaagttcatcgggcgaaagcgaatcacaagaagataaagtttcg
caattagcagctgaagtcttatcgaaaataccaaaccctatcgattacgaaacaaccgaa
aaattaatcggtgtcgataaaaaaccactagatgtggtcctcctccaagaaattttaagg
tataatacgttattggttgacataaggacatcactggacgagttacaaaaaggaatcaaa
ggtttagtcgtaatgtcgtcacagttggaggaaatttttacgtgtatttttgaaggacga
gttccttccgattggcttaaagcttatgcatcattgaaactcttgggctcttggacacgc
gatttaatagcaagagtcgaacatttcgagacatgggcgagcacaacccacccccctatg
ttcttctggctgtcggcttacaccttcccgacggggtttctgacagccgttttgcagacc
acagcccgagccaacgaagtccccatcgatacgctgagttgggagtttaccgtcataacc
gtcgacgaaagccaactgatcgagcgtcccgaaaacggggtttatgtcaaagggatgttc
ctcgaaggagcgggttgggacaggaagaatgcgtgcttgattgaaccccagccgatgcaa
ctggtatgcgccatgccagtgattcatttcaagccgcaggaggtgctgaagaagaagaca
cgagggttgtattcgtgtccgtgttattatttcccgatcaggacgggggcgccgaatagg
ccggcgtttgttgttgcagttgatttgaagagcggggctgaaaatgccgatttttggatc
aagaggggaacggccctgctccttagtttgtcgaattaa

DBGET integrated database retrieval system