KEGG   Tribolium castaneum (red flour beetle): 656268
Entry
656268            CDS       T01046                                 

Symbol
belle, PL10, bel
Name
(RefSeq) ATP-dependent RNA helicase belle
  KO
K11594  ATP-dependent RNA helicase DDX3X [EC:3.6.4.13]
Organism
tca  Tribolium castaneum (red flour beetle)
Brite
KEGG Orthology (KO) [BR:tca00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:tca03019]
    656268 (belle)
   03041 Spliceosome [BR:tca03041]
    656268 (belle)
   03036 Chromosome and associated proteins [BR:tca03036]
    656268 (belle)
Enzymes [BR:tca01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.4  Acting on acid anhydrides to facilitate cellular and subcellular movement
    3.6.4.13  RNA helicase
     656268 (belle)
Messenger RNA biogenesis [BR:tca03019]
 Eukaryotic type
  mRNA surveillance and transport factors
   Transport factors
    eIF4F and regulatory proteins
     656268 (belle)
   mRNA cycle factors
    Common to processing body (P body) and stress granule
     656268 (belle)
Spliceosome [BR:tca03041]
 Other splicing related proteins
  Spliceosome associated proteins (SAPs)
   RNA helicase-like proteins
    656268 (belle)
Chromosome and associated proteins [BR:tca03036]
 Eukaryotic type
  Gene silencing
   RISC (RNA-induced silencing complex)
    656268 (belle)
SSDB
Motif
Pfam: DEAD Helicase_C ResIII
Other DBs
NCBI-GeneID: 656268
NCBI-ProteinID: NP_001153721
UniProt: D6WM75
Position
LG5:complement(11063777..11068237)
AA seq 699 aa
MSNAPNQNGSGLEQQFAGLDLQSRAPSGRYVPPHLRNKQSSAESSYDRDRGESRGGSGRS
NYSSRGGGRDNRAGDYSSFNTRNRRDNFQNGETFEREEWGRGGGGGGGGRQQERERDLPR
NDRWQEPEKPREGGGGRWSDNRNENRGGGGGGGGGGGRWNDNRDRHNENDWTVPMPRDER
LEQELFGTGNTGINFSKYEDIPVEATGDKVPRHITSFEEVQLTEIIRNNINLARYDTPTP
VQKYAIPIIVGKRDVMACAQTGSGKTAAFLVPILNQMYEHGPPNITHGRSRRKQYPLGLV
LAPTRELATQIYDESKKFAYRSRVRPCVVYGGAHIGDQMRDLDRGCHLLVATPGRLLDMI
DRGRIGLDYCRYLVLDEADRMLDMGFELQIRRIVEKETMPKTGERQTLMFSATFPSPIQM
LARDFLDNYIFLAVGRVGSTSENITQKVVWVEEHDKRSFLLDLLNAAEMSQPSAESLTLV
FVETKKGADSLEEFLHFEGYPVTSIHGDRSQREREDALRQFRSGNTPILVATAVAARGLD
IPHVKHVINFDLPSDIEEYVHRIGRTGRMGNLGLATSFFNDRNRNLASGLLDLLIEAKQE
YPSWLEGVAADGRMPSSGRRGGKSRYGGGGGSSFGGRDYRQQSGGMSRNQRSGGGGGYGN
NGFGNNGGGHYGGLDRGGNFGGNYNSNSNSNSRDDWWEN
NT seq 2100 nt   +upstreamnt  +downstreamnt
atgagtaatgcacccaaccaaaatggatcaggtctagagcagcagtttgctggtctggac
ttgcagagtcgcgcacccagcggccgttacgtgcccccgcacttgcgtaacaaacagagt
tcagccgaaagtagctacgatagagatagaggcgaatccagaggcggaagcggaagaagc
aactacagcagtagaggcggcggaagagataaccgcgcaggagactactccagcttcaac
actaggaatcgccgtgacaatttccagaatggcgagacctttgagcgagaggagtggggt
cgaggtggcggcggcggcggcggcggtcgccaacaggagcgggagcgtgacttgccccgt
aatgatcggtggcaggaaccagagaagcctcgcgaaggaggcggcggtcgttggagcgac
aaccgcaacgagaatcgcggaggcggtggtggaggcggcggcggaggcggtcgttggaac
gacaaccgagaccgtcacaacgagaacgattggaccgttccgatgccgagagacgaacgt
ctcgaacaggagctcttcggcacgggcaatacgggcatcaacttcagcaagtatgaagat
atacctgttgaagcaaccggggacaaagtcccgcgccacattacatcttttgaggaagta
cagttgactgagatcatacggaacaacataaacttagcacgttatgatactccgactcca
gtacaaaaatacgcaattccgataattgtgggcaagcgagatgtgatggcttgcgcccag
actgggtctgggaagactgcagcgtttctagtgccgattttgaaccaaatgtacgaacat
ggacccccgaatattactcacggacgcagcagaaggaagcagtacccccttgggctggta
ttggcaccgacaagagaactcgccacccagatctacgacgagagcaagaagttcgcctac
aggtcgcgcgtacgcccctgcgttgtttatgggggcgctcatattggcgaccagatgcgc
gatttggaccgcggctgccacctcctggtggccacccccggccgcctcctcgacatgatc
gaccgcggccgcatcggccttgactactgtcgttacttggtccttgacgaagccgatcgt
atgctcgacatgggtttcgagttgcaaattcgtcgaatcgtcgagaaagaaacgatgccg
aagaccggcgagcgtcaaaccctcatgttttcggcgactttcccctcgccaattcaaatg
ctcgcacgcgattttctcgacaattacattttccttgctgtgggtcgtgtcggctccacc
tccgagaacatcacccagaaggtggtttgggtcgaagagcacgacaagcgatcgttcctc
cttgatcttctcaatgcggccgaaatgagccaaccgtcggccgaaagcttgactcttgtt
ttcgttgaaacgaaaaaaggggccgactctttggaggagttcctccactttgagggttat
cccgtgacgtcgattcacggcgatcggagtcaaagagagcgtgaggatgctttgaggcaa
ttccgttcggggaataccccgattttggtggcaacagccgtggcggcgagagggttggat
atcccccatgtcaaacatgttatcaattttgatttgccttcggatatcgaagagtacgtt
catagaattgggcgtacgggaagaatgggtaatttgggcttggcaacgtcgttcttcaat
gatagaaacaggaatttggcgagtggtttattggatttgttgattgaggccaagcaggag
tacccgagttggttggagggcgtagcagccgacgggcgaatgcccagttcgggacgcaga
ggcgggaagagccggtatggaggtgggggaggaagcagttttgggggaagagattatagg
caacagtccggggggatgtcccgaaatcagagatctggaggcggtggaggatatggaaat
aacgggttcggaaacaatggaggtggccactacggcggcctcgaccgcggcggcaatttc
ggcggtaactacaactcgaactcgaactccaacagtcgcgacgactggtgggagaattag

DBGET integrated database retrieval system