KEGG   Tribolium castaneum (red flour beetle): 656941
Entry
656941            CDS       T01046                                 
Symbol
Dlic
Name
(RefSeq) dynein light intermediate chain
  KO
K10416  dynein cytoplasmic 1 light intermediate chain
Organism
tca  Tribolium castaneum (red flour beetle)
Pathway
tca04145  Phagosome
Brite
KEGG Orthology (KO) [BR:tca00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04145 Phagosome
    656941 (Dlic)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:tca04131]
    656941 (Dlic)
   03036 Chromosome and associated proteins [BR:tca03036]
    656941 (Dlic)
  09183 Protein families: signaling and cellular processes
   04812 Cytoskeleton proteins [BR:tca04812]
    656941 (Dlic)
Membrane trafficking [BR:tca04131]
 Protein recycling
  Rab GTPases and associated proteins
   Rab4 associated proteins
    656941 (Dlic)
Chromosome and associated proteins [BR:tca03036]
 Eukaryotic type
  Centromeric chromatin formation proteins
   SAC (spindle assembly checkpoint) factors
    Motor proteins
     Dynein complex
      656941 (Dlic)
Cytoskeleton proteins [BR:tca04812]
 Eukaryotic cytoskeleton proteins
  Microtubules
   Tubulin-binding proteins
    Dyneins
     656941 (Dlic)
SSDB
Motif
Pfam: DLIC ABC_tran G-alpha PduV-EutP Roc TniB
Other DBs
NCBI-GeneID: 656941
NCBI-ProteinID: XP_008194237
Position
LG5:complement(12356638..12358749)
AA seq 465 aa
MPEEVAKPTDDSKKNLWSQILSDVQNNGNPKLPSCKQVLVLGDNECGKTTIVAKLQGVED
PKKGSGLEYAYIDVRDDYRDDQTRLSVWVLDGDPGHTDLLKFALNEETFQHTLVILTVTM
TAPWSILEQLQHWASVLADHLDKLKLDVDLRQNRRQHIVKMWQEYVEPGDELDPASPMKR
SSRNFGDGEDGLEEQTSLPEGTLTNNLGLDIVVVVTKTDYIQTLEKEHDYRDEHLDFMQQ
WIRKFCLQYGAALFYTSAKEDKNCDLLYKYLTHRIYGFPFRTPALVVEKDAVFIPAGWDN
MNKIRILYENLHTCKPDDYFRDIIVQPATRKTINRETELLAEDEQAFLARQQQILFAGGN
NLQGPRLGETPIRSSPLGKATLDGSKVVSTPGGEGVLANFFNSLLHKKTGSSPGNSLVNK
SGGPESLDKATMRSDAAAELDRLARGGKKSGPASGSGVDFNASDC
NT seq 1398 nt   +upstreamnt  +downstreamnt
atgccggaagaagttgcaaaaccgaccgatgatagcaaaaagaacttatggtcccaaatt
ttgagtgacgttcagaacaacggtaacccgaaattgccctcttgtaagcaagttctggtc
ttgggggacaatgagtgtggcaagaccacgattgttgcgaagttgcaaggggtggaggac
cccaaaaaggggtcagggctggagtacgcctacattgacgtccgggatgattacagggat
gatcagacccgtctcagcgtatgggtgctggacggcgatccggggcacactgatctcctc
aagttcgccctgaatgaagagacattccagcacaccctcgtgatactcactgtgaccatg
acagcgccctggagcatcctcgagcagctacaacactgggcatctgtcttagccgaccat
cttgataagttaaaactggacgttgacttgcgccaaaaccggcgtcaacacatcgtgaag
atgtggcaagagtacgtggagccgggggacgaacttgacccggcctcccctatgaagcgg
agctcccggaattttggggacggggaggacggtctggaggagcaaacgtcgttgccggaa
ggcaccttgaccaataatctgggattggatattgtggttgtggtcacaaagactgattat
attcaaactttggaaaaagagcacgattatagggacgagcatttggattttatgcaacag
tggattaggaagttttgtcttcagtatggagcagctttgttctatacgagcgcaaaggag
gataaaaactgcgatttgttatacaagtatctgactcatcgcatttacggttttccgttc
cggacgccagctctagttgtggaaaaagacgcagtttttataccggccggttgggataac
atgaataaaatccgaatcctgtacgagaatttgcacacttgcaagcctgatgattacttc
cgggacataatcgtgcagcctgcgacccgaaagacaataaaccgcgaaaccgagcttttg
gccgaagacgagcaggctttccttgcacgccaacagcaaatcctcttcgctggcggtaac
aacctccaagggccgcgtctcggggaaacccccatacggtcgtcaccgctcggaaaagca
acgttggatgggtccaaggtcgtcagtacgccgggtggggaaggggtgttggcgaatttc
tttaattcgttgttgcataagaaaaccgggtcgagtccggggaattccctagtgaataaa
tcaggggggcccgagtcgttggataaggcgactatgcgctccgatgctgcagctgaactg
gaccgactggcccgcgggggcaagaagtcggggcccgccagtggaagcggagtcgatttt
aacgcttccgattgttaa

DBGET integrated database retrieval system