KEGG   Tribolium castaneum (red flour beetle): 659289
Entry
659289            CDS       T01046                                 
Name
(RefSeq) probable phosphorylase b kinase regulatory subunit alpha
Organism
tca  Tribolium castaneum (red flour beetle)
SSDB
Motif
Pfam: Glyco_hydro_15 KPBB_C NICE-1
Other DBs
NCBI-GeneID: 659289
NCBI-ProteinID: XP_015834618
Position
LG4:complement(7630811..7639894)
AA seq 1223 aa
MRTRSNSGVRLDYYHRLVHKIIMSNQNPVTGLFPASLENSHAWIRDNVYCIFAVWGLSMS
YKKMADQDEDRAKTYELEQSCVKLMRGLLMAMMQQKEKVERFKQTQNPLDSLHAKYSSQT
GQIVVGDNEWGHLQIDAISLYLLILAQMTASGLQIVFNLDEVAFIQNLVFYIECAYCTPD
YGIWERGDKTNHGLPELNASSIGMAKAALEAMNELDLFGARGGPYSIIHVLADEAQKCQA
VLQSMLPRESSSKEIDSGLLSVVSFPAFAVDDPDLLQYTKDQIIEKLQGRYGCKRFLRDG
YKTPKEDPRRLYYEPWELRMFENIECEWPLFFCYLIIENCFRGNKQGAAEYTQQLENIMI
RTEDGLRYVPELYAVPQELVEAEYKEPGTQKRVALGHCPFLWAQSLYIVGKLLQEGFLAP
GELDPLNRRLCSEKKPDVVVQVVILAEDNEIRDKLAEHDIMVQTISEVAPIEVQPARVLS
HLYTYLGRNKKLGLSGRKSRDVGILSTSKLYSLGDKIFAFTPQFTDMSHNYIASDYELMI
DICKSEINFLKSSWQNMLGRPLVTIACRKLHLDDGKIPLAMITTMKKLKSGYINGTRVTL
GHLNDFLSTSCITNLSFLGCHEDGLPDKLNPQVHQYLEEHLVKSLSSKSSLLKQTHGRTT
RKHMRRRMSVRGAIKKTRSINVDCKLWVSNAFNKLCSADIFMRPILLKHAETLGMEGNTT
IERRGSMFLTNWQDTVDSASPLEHVRSPSPENAPQVPKDLQRKNIPNINVTRHKTNSETQ
YADTEVEELFAMLRESESLDEQGDILQYLVDSKGLDFHTGMLDFGKPITVRDLLKGLYEK
ACQQKMWGLVRHTAGMLGKRVEDLAKSVTDLLVRQKQITVGMPPHNEHTITAPLPESELR
LLIHDAYGEDDSTAMLTQELLVYLAMFIRTEPQLFLEMLRLRVGLIIQVMATELSRTLIC
DGDEASEHLLNLSPFEMKNLLHHIISGKEFAISSVGRGNFSIVSNKSSRISKKSHISLGQ
DSNDEMIEGDRQGQWLRRRRLDGALNRVPRDFYPRVWSVLERCQGIDIAGKVLPQSLTQE
MTSGELKFALAVETVLNTIPQPEYRQLIVEALMVLTLVAEYNIAPSLGGIIQVEHLVHIA
NELFLDDQMKCDGDATLCCAKPKEMRETSKTGGLLCGGAAYICQHFYDSAPSGCYGTMTY
MTRAVAVTLDCLPKQGELDCTIS
NT seq 3672 nt   +upstreamnt  +downstreamnt
atgcgtactaggagcaattccggtgtccgcctggactattaccaccgactcgtccacaaa
ataatcatgtcgaaccaaaacccggtcacggggctgtttccagcaagtttggagaacagc
cacgcctggatccgcgacaacgtctattgcatcttcgcggtgtggggcctttcaatgtct
tacaaaaaaatggctgatcaggacgaagaccgggccaagacttacgagctggaacagtcc
tgtgtcaaactaatgcggggccttttaatggcaatgatgcaacagaaggaaaaggtcgag
cgtttcaagcaaacccaaaacccgcttgattccctccacgccaaatactcgtcccaaacg
ggccagatcgtggtcggtgacaacgaatgggggcacttgcagatcgatgccatttcgctg
tatttgttgattctggcgcaaatgacggcatcgggcctccagatcgtgtttaatctagac
gaggtcgcgtttattcaaaatttggtgttttatattgagtgtgcctattgcacccccgat
tacggtatttgggaacgtggggataaaacgaaccacggtttaccggagctcaatgcgagt
tccatcggcatggcgaaggctgcgcttgaggccatgaacgagttggatttatttggggcc
cgaggggggccttacagcataatacacgttttggccgatgaggcccaaaagtgccaagcg
gttttacaatcaatgctcccacgggagtcaagttcaaaggaaatagacagcgggttgttg
tcggttgttagctttcctgcttttgcagtggatgatcctgatttactccaatacactaag
gatcaaattattgaaaagttgcaaggtcgatacgggtgtaagcggtttttgcgggatggc
tacaagacaccgaaagaggacccccgaaggctgtactacgagccttgggagctccgcatg
ttcgaaaacatcgaatgcgaatggccgttatttttttgttacctaatcatcgaaaattgc
ttcaggggtaacaagcaaggagcggctgaatacacccaacaactcgaaaatatcatgata
cgcactgaggacggcttgagatacgtcccggaattatatgcagttccgcaagaactggta
gaagcggagtataaggagccagggacccagaaaagggtggctttgggacactgtcccttt
ctgtgggcccaatctctttacatcgttggtaagctgttgcaagagggatttctagctcct
ggcgaactggatcccctaaaccgtcgtctctgttcggagaaaaaaccggacgtggtggtc
caagtcgtgattttggccgaagacaacgaaattagggataaactcgcagagcacgacatt
atggtgcaaacaatcagcgaagtggcccccattgaagtgcaaccagctcgggttttgtca
catttgtacacttatctcgggagaaacaaaaagttgggcttgtcggggcgtaaatcccgc
gacgttgggattctcagcactagcaaactgtattcattgggggacaaaatcttcgcgttc
acgccacagtttacggacatgtctcacaattacatagcgagcgactatgaactgatgata
gatatttgcaagagcgaaataaatttcttgaagtcaagttggcagaatatgttgggccgg
ccacttgtaacaattgcgtgtcggaaactacatttagacgatggaaaaatccccctagct
atgatcaccacaatgaagaaactcaaatcgggttacatcaacggcacgagagtcactcta
ggccacctcaacgattttctcagcacgagctgcatcactaatttgagcttcctggggtgt
catgaggacggcttacccgacaaattgaacccccaagtccaccaatacctcgaggagcac
ttggtgaagtcactctcaagcaaatcgtcgcttcttaaacaaacccacggcagaaccacc
agaaaacacatgcgacggcgaatgtcagtgcgtggcgcaatcaagaaaacaaggtcaatc
aacgtcgattgtaagttgtgggtttcaaacgctttcaataaattatgttcagctgatatt
ttcatgcggccaattttgctcaaacacgccgagacactgggcatggaaggaaacacaacc
attgaacgtcgcggttcaatgttcctcaccaactggcaagacaccgtcgacagtgcatcg
ccactcgaacacgtgcgatccccatcccccgaaaacgccccccaggtccccaaagacttg
caacgcaaaaacatccccaacataaacgtgacgcgccacaaaaccaactccgaaacgcaa
tacgccgacaccgaggtcgaggagttgttcgcaatgttgcgcgagtctgagtctctggat
gaacaaggcgacatcctccagtaccttgtcgactccaaagggctggatttccacactggg
atgctcgatttcgggaaaccgatcacagtgcgcgatttgctcaaaggcttgtatgagaag
gcgtgccagcagaagatgtggggcttggtcagacacacggccgggatgttggggaaacga
gtcgaagatttggccaaatcggtgactgatttactagtgcgtcagaagcaaattacagtg
gggatgcccccacacaacgagcatacgatcacggcccccttgccggaaagcgagttgaga
ctgttgattcatgacgcttatggcgaggacgacagtacggcaatgctgacgcaagagttg
ttagtctaccttgccatgttcataagaactgagccacaattgtttttggaaatgttgaga
ttacgagtcgggttgataattcaagtcatggcaacggaattatcccgaacgctgatttgc
gacggggacgaagcgtccgagcatttgcttaatctgagtccttttgaaatgaaaaatttg
ctacatcacataatcagtgggaaggaatttgcaatcagtagcgttggtagagggaatttc
tcgattgttagcaacaaatcaagccgaattagtaaaaaaagtcatatcagtttaggtcaa
gacagcaatgatgagatgatagagggggacaggcaagggcagtggttaagacggcgccgg
ctggatggggccttaaatagggtcccccgtgatttctacccccgggtttggagtgtctta
gaacggtgtcagggtatagacatcgcgggcaaagtcttgccgcaaagcctgacgcaagag
atgacctctggtgagttaaaattcgctttagcggtcgaaacggtcttgaacacaatccca
caacccgaataccgccaattaatagttgaagctttgatggttctaactttggtggcggaa
tacaacatagcgccgtctctaggcgggattatccaagttgaacatttagtccacatcgct
aatgaattatttctcgacgatcagatgaaatgtgacggtgatgccacattatgttgtgcc
aaacccaaagaaatgagggaaacgtccaaaactggaggcttgttatgtggcggcgctgca
tacatttgccaacatttttacgacagcgctccgagcggctgttatgggactatgacctac
atgacgagagcagtggctgtgactttggactgtcttccaaaacaaggagaactcgattgc
acaattagttaa

DBGET integrated database retrieval system