KEGG   Tribolium castaneum (red flour beetle): 659314
Entry
659314            CDS       T01046                                 

Definition
(RefSeq) dnaJ homolog subfamily A member 2
  KO
K09503  DnaJ homolog subfamily A member 2
Organism
tca  Tribolium castaneum (red flour beetle)
Pathway
tca04141  Protein processing in endoplasmic reticulum
Brite
KEGG Orthology (KO) [BR:tca00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    659314
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03110 Chaperones and folding catalysts [BR:tca03110]
    659314
   03029 Mitochondrial biogenesis [BR:tca03029]
    659314
Chaperones and folding catalysts [BR:tca03110]
 Heat shock proteins
  HSP40 / DNAJ
   659314
Mitochondrial biogenesis [BR:tca03029]
 Mitochondrial protein import machinery
  Endoplasmic reticulum membrane and cytosol
   Other ER-memrane and cytosol factors
    659314
SSDB
Motif
Pfam: DnaJ_C DnaJ_CXXCXGXG Anti-TRAP
Other DBs
NCBI-GeneID: 659314
NCBI-ProteinID: XP_015835186
Position
LG5
AA seq 336 aa
MQEGAQDGFAGDSLFSHLFGGGLFGGFGGFPHRRRHKGEDTVHPLKVSLEDLYNGKTSKL
QLSKNVICAACNGKGGRSENFEQCPGCKGRGFKVTYHQIAPGMAQQVQAECSDCHGDGVM
IKEKDRCTTCKGKKVCNETKILEVHIDKGMKDGQKIFFRGEGDQQPDIEPGDVIIILNEK
SHETFQRSGDDLLMNRTISLTEALCGFSFVLRQLDGRDLLIKHPPGDIVKPGDLKAVMGE
GMPMYKNPFEKGNLYITFEITFPESNFADEKTLKSLESMLPPRPVFQMPEGENVEEVDLH
HFDSANDKGAHGSRGEAYASDDEDHMHGPGIQCAHQ
NT seq 1011 nt   +upstreamnt  +downstreamnt
atgcaagagggggcgcaggacggctttgctggcgacagcttgttctcgcacctgttcggc
ggcggtttgtttggcggtttcggcggctttccgcacaggagacgtcacaaaggagaggat
accgtccatccgcttaaagtgtcgcttgaggacttgtacaacggaaaaacgtccaaattg
cagttgagcaagaacgttatttgcgccgcgtgcaacggcaaaggcggcagaagcgaaaat
ttcgaacagtgtcccgggtgcaagggtcggggattcaaagtgacctaccaccagatcgca
ccgggaatggcgcagcaggtgcaggccgagtgctcagactgtcatggtgatggggtcatg
atcaaggagaaggatagatgcacgacgtgtaaaggaaaaaaggtttgtaacgagacgaaa
atcctcgaggtccacatcgacaaaggaatgaaagacggtcagaaaatcttcttccgtggc
gagggcgaccaacagcccgacatcgaacccggcgatgtcatcatcatacttaacgagaaa
tcccatgaaacgttccaaagaagcggcgacgatttgctcatgaatcgcaccattagtctg
acggaagctctctgtggcttcagtttcgtgttgcgccagttggacgggcgcgatttgtta
atcaaacacccaccaggggacattgtgaaaccaggcgatttgaaagcagtgatgggcgaa
ggtatgcccatgtacaaaaatcccttcgaaaagggaaatctctatatcaccttcgaaatc
acattcccggagagtaatttcgcagacgagaagaccctcaaatcattagagagtatgctg
ccgccgcggcccgtctttcaaatgcctgaaggcgaaaacgtggaagaagttgacttgcat
catttcgattcggcgaatgacaagggggcgcatggaagcagaggggaagcgtatgcgagc
gacgacgaggatcacatgcatggaccgggcatacagtgcgcacatcaatag

DBGET integrated database retrieval system