KEGG   Tribolium castaneum (red flour beetle): 659852
Entry
659852            CDS       T01046                                 
Symbol
NLG-3
Name
(RefSeq) neuroligin 3
  KO
K07378  neuroligin
Organism
tca  Tribolium castaneum (red flour beetle)
Brite
KEGG Orthology (KO) [BR:tca00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:tca04131]
    659852 (NLG-3)
Membrane trafficking [BR:tca04131]
 Exocytosis
  Calcium ion-dependent exocytosis
   Others
    659852 (NLG-3)
SSDB
Motif
Pfam: COesterase Abhydrolase_3 BD-FAE
Other DBs
NCBI-GeneID: 659852
NCBI-ProteinID: XP_001810887
BEETLEBASE: TC013963
Position
LG5:3094851..3239312
AA seq 854 aa
MAPAGVVLNTVLVVVAAVRVAAADLTSRTVHTKYGDVSGVIVQLDAKHLEPVEVFRGIPY
ASPPLGRLRFMPPVTGALWSGVKIADKFSPVCPQRLPDIANETAALKRMPRGRLEYLKRL
LPHLQNQSEDCLYLNIYAPAQAGTREGSSSSKYPVVVFVHGESYEWNSGNPYDGSVLASY
GGVVVVTVNYRLGILGFLNANTDPYSRSPANYGLMDQIAALHWIQENIAVFGGDPTNVTV
VGHGTGAACVNFLLTSSAVPEGVLFHRAILMSGSALSPWALIQEPSRYAAQVAIHANCSP
ELPHPHLLKCLRERPLETLLSTPVIAPEFAFAFGPSVDGVVIDTGEPPGDNPHYEFDALK
PVKAEPQNAINILNNVLLRKSVVSKLSRYDLLLGVVKAEAYFAFNGEDVQYGIEADRRSK
ILRTFVRNTYSYHLSEILATIVNEYTDWERPVQHPINIRDETLEALSDAQYVAPVVHTAD
LHSAEHRNSFLYVFDYQTKFGDYPQRQGCIHGEELPYLFGAPLVGGFMHFVRNYTKSEVL
LAETTMIYWSNFARTGNPNEPPEGARQERNRFKNIDWTAYEAVHKKYLNLDTKPKLKNHY
RAHRLSFWLNLVPDLHKPGGDDVPMSHHKLVDDDPPPPKLPSLNPRKLPTTETPDFARTL
SSNTSLLATVETPDSTERVEELGGLSTTTHPVEDGFAAYSTALSVTIAIGCSLLILNVLI
FAGVYYQRDKTRMNENREPKKRNENGQMPNNICGDLESSIIGVKSDPATILGHHHSHHQL
PPPEFADLPQNNATLPRPPPPPKISKANVNTLSSNQVPENQPLLSTHSIQLINTGTLTKK
NVHAKQNTMEELRV
NT seq 2565 nt   +upstreamnt  +downstreamnt
atggcaccggccggcgtcgtcctcaacacagttctggtggtggtggcggcggtgcgcgtg
gcggcggccgacctcacctcgcgtacggtgcacacgaagtacggcgacgtgagtggcgtt
atcgtgcagctggacgcgaaacatttggagccggtggaggtgttcaggggcatcccctat
gccagccccccgctgggcaggctgcggttcatgccgccggtgacgggggccctgtggtcg
ggggtcaaaattgccgacaagttcagtccggtgtgtccgcagaggctgccggatatcgcc
aacgagacggcggcgctcaagaggatgcccagggggcggctggagtacctcaagaggctg
ctgccgcatctgcagaaccagagcgaggactgcctctacctcaatatctacgcaccggcg
caagctgggacccgcgagggcagctcgtcgtccaaataccccgtggtggtgttcgttcat
ggagaaagctacgaatggaattcgggcaacccttacgacggcagcgttcttgctagttac
ggcggtgtcgttgtagtcaccgtaaactaccgacttggcattttaggcttcctgaacgcc
aacacggatccttactcccgttctccggccaactacggcctcatggaccaaatagccgcc
ctccactggatacaggaaaacatcgctgtatttggcggagatccaacaaacgttaccgtt
gtaggccatggaactggagcggcttgcgtcaacttcctgttaacgtccagcgcagttcct
gaaggtgtgctgttccaccgagccatcctcatgtcgggatcggccctctccccctgggcg
ttgatccaggaaccgtcccgatatgccgctcaagtggccatccacgctaactgctcgcca
gaactgccacatccccacctgctcaagtgccttcgagagagacccctggaaacgctcctg
tccacgcctgtcatcgcaccggagttcgctttcgctttcggcccgagcgtcgacggagtc
gtcatcgacaccggagaaccaccaggtgacaacccgcactacgagttcgacgcgttgaag
ccggtgaaggccgagccccagaacgccatcaacatcctcaacaacgtcctcctgcgcaaa
tcggtggtgtcgaagctgtccaggtacgacctgctgctgggggtggtgaaggctgaggcg
tacttcgccttcaacggagaagacgtccagtacggcatcgaggccgatcgcaggtcgaaa
atcctgcggacctttgtccgaaacacgtacagttatcacctctcggagattctagcgacg
atcgttaatgaatacacggattgggaaagacccgttcaacacccgatcaatattcgagat
gagacgctggaagcattgtcggatgcacaatacgtagcacccgttgtgcatactgccgat
ttgcattcggctgagcaccggaattcttttctgtacgtcttcgattatcagaccaagttc
ggggattacccgcagagacaaggatgcatccatggcgaggaacttccctatttgttcggc
gccccgcttgtcggaggattcatgcactttgtaagaaactacaccaagtccgaggtcctc
ctcgcagagaccaccatgatctattggagcaactttgcgaggacgggaaacccaaatgag
ccgccagagggagcccgtcaggagcgaaatcgcttcaaaaacatcgattggactgcctac
gaagccgttcataagaaatatctgaatttggataccaaacccaaactgaaaaaccattat
cgggcccatcgtctttcattctggctgaacctcgtcccggacttgcacaagcctggcggc
gacgacgtgcccatgtcccatcacaaactggtcgacgacgacccaccgccccccaaactc
ccgtcgctcaacccacgcaaactcccgacgaccgaaaccccggacttcgcccggacttta
agctccaacacctcgctgctcgcaacggtggagaccccggattcgaccgaacgcgtggag
gagttgggcgggctgagcaccacgacgcaccccgtcgaagacggctttgctgcctattcc
accgcgctgagcgtcaccatcgccatcgggtgttcgctcctaatcctgaacgttctgatt
ttcgcgggtgtttactaccaacgcgacaagacgcgaatgaatgagaatcgagagccgaaa
aagcggaacgaaaacggacaaatgcccaacaatatttgcggcgatttggagagcagcata
ataggtgtgaagagcgacccggccaccattctgggccaccaccactcccaccaccagctg
ccgcccccggagttcgccgacttgccgcagaacaacgccacgttgccgcggccgccgccg
cccccgaaaatctccaaagccaacgtgaacacgttgtcgtcgaaccaagtgccggagaat
caacccctgctttccacacacagtatacagttgattaacacggggacgttgacgaagaag
aacgttcacgccaaacaaaacacgatggaggagttgcgggtgtga

DBGET integrated database retrieval system